SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479153320|ref|YP_007783095.1| from Ruminococcus sp.

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479153320|ref|YP_007783095.1|
Domain Number 1 Region: 9-306
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.14e-68
Family Methylenetetrahydrofolate reductase 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479153320|ref|YP_007783095.1|
Sequence length 310
Comment 5,10-methylenetetrahydrofolate reductase [Ruminococcus sp. SR1/5]
Sequence
MKLSEAMREKMLLSFELFPPKTEKGMANLPGTIEHLMKYRPEYISCTYGAGGGNVGANRE
VCQMIRNAGTIPVTHFTVIKNTKEGIRQQLERYLADGVDHMLALRGDIPLGETTTCGDFN
YATDLVKFVRNEFGDKFEIAVAGSPEGHIACRSLEADIAVLRQKQDNGADYIMTQLCWDM
EQFKYWLDAIREAGVTMPVDVGVMPILDQAATINMALSRNGCVMDSELCRLISRNWLFPN
PFNAKDADGKPFDMFYEDKVKRFKEEGIEYTIRQIDEYRALGVDGIHLYALNKWKDVSEI
IDRSGLRTLI
Download sequence
Identical sequences D4LHX1 U2ELH1
gi|479153320|ref|YP_007783095.1| WP_015525303.1.94155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]