SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479154211|ref|YP_007783986.1| from Ruminococcus sp.

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479154211|ref|YP_007783986.1|
Domain Number 1 Region: 1-290
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.49e-71
Family Methylenetetrahydrofolate reductase 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479154211|ref|YP_007783986.1|
Sequence length 292
Comment 5,10-methylenetetrahydrofolate reductase [Ruminococcus sp. SR1/5]
Sequence
MKMKELFDRGEFVVSAEVGPPKGIHVDELVEEAKTYLKGVHAVNVTDNQSSVMRLGSLAM
CKVLKDAGMDPIFQLACRDRNRIALESDLLSAAMLGIENILCLTGDHTKMGDHPQAKPVF
DLDSVSLLHTVQLLESGVDLGGNQLVGEPPKFSKGAVVSPCSDSVDAQLAKMERKVAAGA
DYFQTQAVFEPEKFIKFMEKAKQFGKPVQVGIIIPKSAGMAKFMNNNVAGIHVPDEMIEE
LKADKEKTKAGITGVEIAARIIKECKPYCQGVHIMALGWESKIPALLEQAEI
Download sequence
Identical sequences A0A1C5S0Q0 A0A1G5D2C2 D4LKG2 R5NA69
2004024598 WP_015526188.1.100942 WP_015526188.1.70591 WP_015526188.1.94155 gi|479154211|ref|YP_007783986.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]