SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479154809|ref|YP_007784584.1| from Ruminococcus sp.

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479154809|ref|YP_007784584.1|
Domain Number 1 Region: 218-412
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.02e-71
Family B3/B4 domain of PheRS, PheT 0.00000632
Further Details:      
 
Domain Number 2 Region: 481-691
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.41e-43
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00045
Further Details:      
 
Domain Number 3 Region: 39-205
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.76e-41
Family Myf domain 0.0069
Further Details:      
 
Domain Number 4 Region: 707-804
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 7.45e-25
Family Anticodon-binding domain of PheRS 0.0005
Further Details:      
 
Domain Number 5 Region: 420-489
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000732
Family Domains B1 and B5 of PheRS-beta, PheT 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479154809|ref|YP_007784584.1|
Sequence length 805
Comment phenylalanyl-tRNA synthetase beta subunit [Ruminococcus sp. SR1/5]
Sequence
MNTSLSWIKTYVPDLDVTAQEYTDAMTLTGTKVEGFTELDADLDKIVIGQIDKIEKHPDA
DKLIICQVNIGTESVQIVTGAPNVKEGDKVPVVLDGGRVAGGHDGKMTPGGIKIKKGKLR
GVESFGMMCSIEELGSTREMYPEAPEYGIYIFPEDAVVGESAVKALGLDDVVFEYEITSN
RVDCYGVLGIAREAAATFQKKFCPPIVEVKENDEKASDYVKVTVEDPELCPRYCARVVKN
VKIGPSPKWMQRCLASNGIRPINNLVDITNYVMEEFGQPMHAYDLDTIANQEIVVRRAGK
DEKFVTLDGQERIMDENVLMICDGEKAVGIAGIMGGENSMITDDVKTVLFEAACFDGTSI
RLSSKRIGLRTDASGKFEKGLDPNNAQAAIDRACQLMEELGAGEVVGGMVDVCSETREPS
RVKFEPEKINKLLGTSLTKEEMIDYLGRVELAYDEKTDEIVAPTFRQDIHCNADVAEEVA
RFYGYDKIPMTLPTGEATTGKLPFKLRIQEVARDIAEYCGFSEGMSYSFESPKVFDKLCI
PEDSDLRKVITISNPLGEDYSIMRTSTLNGMLASLSTNYNRRNKDVRLYELGNIYLPKSL
PVTELPDERTMFTLGMYGKGDFFDMKGVCEEFFEKIGMKKKVTYDPNSGKPFLHPGRQAN
MIYEGKVVGYLGEVHPAVADNYSIGEKAYIAVIDILDVLEFAGFNHKYTGIAKYPAVTRD
LSLVVPHAVLAGQIEEIFDQRGGNILESYQLFDIYEGAQIEKGFKSMAYSLVFRAHDKTL
GENEISAAMKKIMNGLNGLGIELRS
Download sequence
Identical sequences D4LM60 R7GTZ2
gi|479154809|ref|YP_007784584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]