SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479154990|ref|YP_007784765.1| from Ruminococcus sp.

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479154990|ref|YP_007784765.1|
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.06e-34
Family Ribosomal protein L6 0.0000452
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.15e-26
Family Ribosomal protein L6 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479154990|ref|YP_007784765.1|
Sequence length 179
Comment LSU ribosomal protein L6P [Ruminococcus sp. SR1/5]
Sequence
MSRIGRLPVAIPAGVEVTVADGNVVTVKGPKGTLERALPTELEIKVEDGHVVVTRPNDLK
RIKALHGLTRSLIHNMVVGVSEGYKKELEVNGVGYRAAKQGKKLVLNLGYSHPVEMEDPE
GLESTVDGNKIIVSGISKEKVGQYAAEIRDKRRPEPYKGKGIKYVDEVIRRKVGKTGKK
Download sequence
Identical sequences A0A1C5V0G2 A0A1G5C8V3 A0A1Q6K445 D4LMP1 U2DA53
gi|479154990|ref|YP_007784765.1| WP_015526929.1.100942 WP_015526929.1.70591 WP_015526929.1.94155 2004028343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]