SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479155185|ref|YP_007784960.1| from Ruminococcus sp.

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479155185|ref|YP_007784960.1|
Domain Number 1 Region: 7-242
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.26e-50
Family PP-loop ATPase 0.00015
Further Details:      
 
Domain Number 2 Region: 224-306
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000889
Family MesJ substrate recognition domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479155185|ref|YP_007784960.1|
Sequence length 318
Comment tRNA(Ile)-lysidine synthetase, N-terminal domain [Ruminococcus sp. SR1/5]
Sequence
MITRVRKYIRDNRMLKAEDMVVAGVSGGADSIAMLHILKSLQKEIGFSMEVVHVHHGIRG
QEADRDEQFVEKICRDWGIPFRSRHYPVPELSGKWKLGEEETGRIVRKQAFQEEKKRLGF
SGEQSKKNGQFRVALAHNRNDLAETMLHHLARGTGIRGLSGIQAVSGEIIRPVLCLERKE
IVNYLKERGISYITDSSNLSDNYTRNRIRNHILPAMEQKINAKAVEHMAETARVLAEADS
YLQKKGRELLAGCRKENGYLLDEKFFAQDPILQEYAVMEAFEILSGKRKDFTSLHVDQVL
SLQKKKTVVISTFRNRCG
Download sequence
Identical sequences D4LN86
gi|479155185|ref|YP_007784960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]