SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479155248|ref|YP_007785023.1| from Ruminococcus sp.

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479155248|ref|YP_007785023.1|
Domain Number 1 Region: 58-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.57e-24
Family Ribosomal protein L9 C-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.92e-17
Family Ribosomal protein L9 N-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479155248|ref|YP_007785023.1|
Sequence length 148
Comment LSU ribosomal protein L9P [Ruminococcus sp. SR1/5]
Sequence
MKVILLEDVKSLGKKGQIVNVSDGYARNMILPKKLGVEATSKNLNDLKLRKANEEKVAQE
NLDAAKAFAEELSTKEVILTLKVGEGGRTFGSVSSKEISEAAKKQLNLDIDKKKLQLENP
IRNLGVTNVPVRLHPKVTGSLKVWVKEA
Download sequence
Identical sequences A0A1C5R6S5 A0A1G5ABB9 D4LNE9 R7GZ03 U2DKM5
gi|479155248|ref|YP_007785023.1| WP_015527184.1.100942 WP_015527184.1.70591 WP_015527184.1.94155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]