SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479155548|ref|YP_007785323.1| from Ruminococcus sp.

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479155548|ref|YP_007785323.1|
Domain Number 1 Region: 5-104,240-461
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.59e-97
Family Bacterial dinuclear zinc exopeptidases 0.000000475
Further Details:      
 
Domain Number 2 Region: 105-240
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.01e-34
Family Aminopeptidase/glucanase lid domain 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479155548|ref|YP_007785323.1|
Sequence length 464
Comment Aspartyl aminopeptidase [Ruminococcus sp. SR1/5]
Sequence
MERRNAWLSYKEAEETEMEKLAKAYREFLDKGKTERECVAEIVKEAEAAGYESLESKLEK
GEKIKAGDKVYAVGMKKIVALFHVGTEELSGGMSILCAHIDSPRLDIKQNPLYEDTDLAY
LDTHYYGGVKKYQWVTLPLAMHGVVAKKDGSIVEISIGEDVEDPVLYITDLLIHLSGKQL
QKKAAEVIEGEMLDILIGSRPLAELPDDSKKDAVKQNVLKILNEKYGIEEEDFLSAELEI
VPAGKARDCGLDRSMIAAYGQDDRVCAYTSLAAMLEMEETPKRTGCCLLVDKEEIGSVGA
TGMQSRFFENSVAELLDGMGCYSELALRRALRNSSMLSSDVSAGYDPAYGEAFEKKNAAY
LGRGIVLNKFTGARGKSGSNDANAEYVARVRRIFDDHNVAFQTAELGKVDFGGGGTIAYI
AALYGMEVIDSGVAVLSMHAPWEVTSKADVYEAYKAYKAFLLDA
Download sequence
Identical sequences D4LP99
gi|479155548|ref|YP_007785323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]