SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|494685184|ref|YP_007950758.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|494685184|ref|YP_007950758.1|
Domain Number 1 Region: 73-137
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000719
Family NfeD domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|494685184|ref|YP_007950758.1|
Sequence length 153
Comment Putative activity regulator of membrane protease YbbK [Actinoplanes sp. N902-109]
Sequence
MELMVWIVVAVVFAVAEIFTTTLFLLMFAAGAVAAAGAAGLGAPVPAQAGVFVVVSALTL
AGVRPALHRRLSRSAGPSFGMERMRGASAVVVEQVDAGHGMVRVDGELWQARALEGMGTS
VPGERVRIVDVSDGTALVWPAALPGGAADPTLD
Download sequence
Identical sequences R4LCV6
WP_015620836.1.60444 gi|494685184|ref|YP_007950758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]