SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|494686178|ref|YP_007951752.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|494686178|ref|YP_007951752.1|
Domain Number 1 Region: 74-585
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.88e-203
Family Heme-dependent catalases 0.0000000000455
Further Details:      
 
Domain Number 2 Region: 620-749
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000000687
Family Catalase, C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|494686178|ref|YP_007951752.1|
Sequence length 755
Comment catalase [Actinoplanes sp. N902-109]
Sequence
MDASKPAKAVKNAVESATAKVADALTPDRVPGSPGSAPAPLEEPTTPHDPLPPKDEQGTP
ATVTPTGAETGVPPIKKGQQGAYLTTSQGARLRDTDHSLKAGPRGPILLQDHHFREKITH
FDHERIPERVVHARGTGAHGVFTAYGTAGSVTRAGFLKKGTETPVFVRFSTVLGSRGSAD
TVRDTRGFATKFYTDEGTFDLVGNNIPVFFIQDAIKFPDVIHAGKPHPDREIPQAQSAHD
TFWDFVSLHTEAQHHTIWNMSDRGIPRSYRTMEGFGVHTFRMVNDAGETSLVKFHWKPKL
GVHSLDWEEAQLLAGVDPDFHRRDLYDAIEAGAFPEWELGIQVFPDTAEETFAGIDLLDP
TKIVPEELAPVQAIGKLVLNRTPTNFFAETEQVAFHLGHLPPGIDVTNDPLLQGRLFSYV
DTQLTRLGGPNFSQIPINRPHADVNDMLRDGFHQHAVHAGVAPYRPNSLDGGNPFPAGDK
ENAFLDVPVVVAEAPKVRANPASFEDHYSQVRLFWLSMSPVEREHIIRAYTFELAKCYEQ
AIKERQLQCLANIDPVLCEQVATGLGLPAPQPTVPLAEVEASPALSQVRGEWPADGRMIG
IVVDAAAGDLDGVHEVRRAIFDAGMVPLLIAAHGGMLGDLPVQRTFATARSVEYDAILLA
GAPAPAPDAIGARDAKAGASGPAPVDPRVLLLVEEAWRHAKAVGAWGAGTTVLDLAGVRG
TPGVVTAATGAEALTALQALLPAHRVWERFPATVA
Download sequence
Identical sequences R4LD74
gi|494686178|ref|YP_007951752.1| WP_015621830.1.60444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]