SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|494688581|ref|YP_007954156.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|494688581|ref|YP_007954156.1|
Domain Number 1 Region: 26-103
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.000000126
Family Heme-dependent catalases 0.012
Further Details:      
 
Weak hits

Sequence:  gi|494688581|ref|YP_007954156.1|
Domain Number - Region: 179-229
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.00349
Family Heme-dependent catalases 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|494688581|ref|YP_007954156.1|
Sequence length 232
Comment putative phosphodiesterase [Actinoplanes sp. N902-109]
Sequence
MKVGRALLVAGVAAGAGAGLRLAHARHERILHPDGRSFTGCLQITGRGEPTGAALLDRPD
RHPVTVRISKGAGTWPGWPDVLGVALRVHGPVAGHRTDLLFSTAGRGRFSKHLPTLRRSF
DTGYGTITSYRTGTGRKLYLSVTCDPDSTPLGRTLESVVAAAAGDGARLLLTDGAGRVLG
RVTFGQLCPASTDDALAFDPGNAPADLHPSGLVHASRCVTYKWARRWRGQRA
Download sequence
Identical sequences R4LWP1
gi|494688581|ref|YP_007954156.1| WP_015624232.1.60444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]