SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|494690104|ref|YP_007955678.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|494690104|ref|YP_007955678.1|
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily FlgN-like 0.0000000549
Family FlgN-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|494690104|ref|YP_007955678.1|
Sequence length 161
Comment hypothetical protein L083_7688 [Actinoplanes sp. N902-109]
Sequence
MSLTDLSSVLWRARELLELLLFKLEEEQLLLASNRSRWLAHATREVEVVLDQIRQTEVAR
AAYAQAVALELGLPAEASLGQLADAAPAPWSDLLHQHRKAFLTLTSEISTMADANRDLLT
AGQRAARETMLAFAGTVETYSSQGKTVSGGVRRPSLVDEAI
Download sequence
Identical sequences R4LRT8
WP_015625754.1.60444 gi|494690104|ref|YP_007955678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]