SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|494684955|ref|YP_007950529.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|494684955|ref|YP_007950529.1|
Domain Number 1 Region: 315-441
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000632
Family GAF domain 0.023
Further Details:      
 
Domain Number 2 Region: 696-803
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000291
Family Histidine kinase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|494684955|ref|YP_007950529.1|
Sequence length 804
Comment protein serine/threonine phosphatase with GAF(s) sensor(s) [Actinoplanes sp. N902-109]
Sequence
MGYALGAGCAWILFHASAVAVFYPPAGVTLGALLLTARRRWVWVLGAAGVVEFGVDVWQG
QRAVVALGFVVANVVEPLVGATLLRRWRPGAIRLTQRSTMMLFLACCVGAGPLAGSLIGA
TTITLGLGRTFSGAVAPYWAGDALAVLTLGVAIAGSRRARVREVPGAALVLVATAAVTVL
GFWPHEVPLSYLPVPVLILVAFRGQVAILAAAGFVMAFVANLVTAGGRGPWAVLAQQPRL
EAATLQVYLALAVLGAWMLAIAVVERDEARTESAREVAARRRLEAVQDVTAGLATATTTE
QIAVVLAERGVAGLADTGSVALIDRRRGVIRLWRAGQPGPAREMPLSDAWAEPATEVARV
GRPVALGSDSEIRQRFPYAATAGGVLAVPVQRGNRTVGALSFGFLQPGVPGAEVASMAET
LATLAAQSLERAQLYEAEHAAAHELQRALLPRIDADLPGAQVGVCYQPAERGHEVGGDWY
DAFELPGHRVGFAVGDVVGHDLRAATAMGRLQYVLRSAALSGAEPARVLEILDDACPAIP
RAECATVGYAEYCPADGTLTYTCAGHPPPVLVVDGRAQLLMGGRSQPLHVRGRPRSQARV
ECPAGAMLVWYSDGLVERRTRSLDRGLEQLTELAGRLTGDDPQAWCDALLTGMTEGEPTR
DDVVVACLRLDGSTLTTGQSTVLRHTLIDVGQLGQVRAALRVWAEREALSAEHTEALLVV
CSEALTNGLEHAYAGRAEGGAVDLRVLRVNRRQIRVEVSDRGRWRSGHPDPSRGFGLVLI
ARMAARATVELSENGTCLVATLPG
Download sequence
Identical sequences R4LK24
gi|494684955|ref|YP_007950529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]