SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|494687056|ref|YP_007952630.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|494687056|ref|YP_007952630.1|
Domain Number 1 Region: 462-600
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 8.25e-34
Family Flavohemoglobin, C-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 377-472
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 7.53e-26
Family Ferredoxin reductase FAD-binding domain-like 0.0025
Further Details:      
 
Domain Number 3 Region: 593-694
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.73e-22
Family 2Fe-2S ferredoxin-related 0.012
Further Details:      
 
Domain Number 4 Region: 158-299
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.0000000107
Family PNP-oxidase like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|494687056|ref|YP_007952630.1|
Sequence length 698
Comment Oxidoreductase FAD-binding domain-containing protein [Actinoplanes sp. N902-109]
Sequence
MSWEKEDLEAVVGRPLPMIVRKQISALDEGCRVVLAHSPIAAFGYRDPGGVARTTFIGGR
PGFARVLSPGRIAVPAPGPVEAGGAVSLFFLLPGVGEVLRVNGTAGAPATAATTIDITEA
FVHCAQAVLRARLWQPPVPPPVPPAPQVTGGGPLSHPGIADFLAAAPFLALSSWDGAGGS
DTSPRGDQGAAVRLLDGRTVLVPDRRGNKRADTLHNLLHDDRVSFAALVPGRSGVLHVRG
RGSITDDPDLLAGLALRGVPPHLGIVIAVEHADLTAGDAVTGARLWNPAAHVDRGQVPDL
LALGGEHLAANLAGSAGGPPGWLMKLIGAVPGLTRLLRLAMNRAYRSGLRKEGYADVTPV
PARRSAPPAVVPDGSLRDVRVVEVRRETPAAMTLVLADGGTFDFHPGQFFTLGTEIDGRS
VRRAYSASSAPGSARLELTVKHVEGGRFSAHVHRNLRVGDRLTVRGPSGSFHIGPQAPAD
LVLVAAGSGITPMLSMIRAWCAAPAAGRVCLLYSSRTAADIIFADALAELAEAHPGRLTV
THVLTSRDGRLTAAAVDHWLTAAAPAPAAEHYLCGPEALMDLVEQVILTRGTPAARIHRE
TYTRAPGPPAPPTIPRQLTVTSRGTATVEPGQTLLDAALAAGLPLPFSCTVGTCGDCIVR
LCDGTVTPPDPALASTGTVRTCVSYPMSDITLDIAGTR
Download sequence
Identical sequences R4LSC0
WP_015622708.1.60444 gi|494687056|ref|YP_007952630.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]