SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387889765|ref|YP_006320063.1| from Escherichia blattae DSM 4481

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387889765|ref|YP_006320063.1|
Domain Number 1 Region: 14-105
Classification Level Classification E-value
Superfamily YccV-like 1.11e-28
Family YccV-like 0.00000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387889765|ref|YP_006320063.1|
Sequence length 115
Comment DNA-binding protein [Shimwellia blattae DSM 4481 = NBRC 105725]
Sequence
MLSNNPREVTMIASKFGIGQQVRHSLLGYLGVVVDIDPEYSLDEPTADDLAVNAELRASP
WYHVVMEDDDGQAVHTYLAEAQLSGEIPQEHPEQPSMDELAASIRQQLQAPRLRN
Download sequence
Identical sequences I2BAJ8
gi|387889765|ref|YP_006320063.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]