SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387608809|ref|YP_006097665.1| from Escherichia coli 042

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387608809|ref|YP_006097665.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.2e-109
Family FMN-linked oxidoreductases 0.0000000000101
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.71e-42
Family N-terminal domain of adrenodoxin reductase-like 0.000000324
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.08e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387608809|ref|YP_006097665.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Escherichia coli 042]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELSHEEILQLIDNFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYLNRMRFATEVVRAVRERVGNDFIIIYRLSMLDLVEGGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSKIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQSFDETILASGIVPRIPPIDGIDHPK
VLSYLDVLRDKAPVGKKVAIIGCGGIGFDTAMFLSQPGESTSQNIAEFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences D3GWP9
gi|387608809|ref|YP_006097665.1| WP_000121429.1.25272 WP_000121429.1.32558 WP_000121429.1.34966 WP_000121429.1.57438 WP_000121429.1.69160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]