SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404476663|ref|YP_006708094.1| from Brachyspira pilosicoli B2904

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404476663|ref|YP_006708094.1|
Domain Number 1 Region: 370-388,424-691
Classification Level Classification E-value
Superfamily HAD-like 5.67e-63
Family Meta-cation ATPase, catalytic domain P 0.00011
Further Details:      
 
Domain Number 2 Region: 172-270
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.7e-29
Family Calcium ATPase, transduction domain A 0.0027
Further Details:      
 
Domain Number 3 Region: 125-174,271-362
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000366
Family Calcium ATPase, transmembrane domain M 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404476663|ref|YP_006708094.1|
Sequence length 700
Comment copper-transporting P-type ATPase [Brachyspira pilosicoli B2904]
Sequence
MVKAGYQVLGKEEDPAIVKAREIKEQKIRLIVSAIFSIPLFYISMAPMVSFVKFPIPSFL
VHHINPQVFSIVAIFLCVPVMISGYKFYTLGFPALFRGSPNMDSLVAIGTTAAFTYSIYS
TVLSFMGLNPHGDNLYYESAAVIITLVQFGKYLEARSKGKTGEAIKKLMGLQPKTATIIK
DGEEKEIKISDVKVDDIVLVRPGEKIPVDGEIIEGYSSVDESMLTGESIPVEKSVGDKVV
GASINKTGSFKFKAQKVGADTALAQIIKLVEDAQGSKAPIAHIADVVSSYFVPAVITIAL
ISGIIWFIALHNFVFSLTVFVSVLVIACPCALGLATPTAIMVGTGKGAELGILFKNAEAL
EVSQKINAVMFDKTGTLTEGKPYVTDIISDDKDKLLLIAASAENGSEHPLGEAIVREAKE
KNIKLLSIENFKAISGFGIETYIDNKKVLMGNDKLMNKENINIENYNSYMDKLSKEGKTP
MYVAYDNKLLGIIAVADKLKKESIEAINRLHKLGIKTAMITGDNKNTANSVAKEAGIDIV
FAEVLPEEKSNEVKKLQEQGFTVAMVGDGINDAPALTQANVGIAIGSGTDVAIESADIVL
VKSNTNDVVTAIELSKATMRDIKQNLFWAFCYNVIGIPIAAGVLHVFREPLIASSIGGFL
TAIMGKDLLLNPIFAALAMSLSSVSVVTNALRLNFFKPSK
Download sequence
Identical sequences J9UJS3
gi|404476663|ref|YP_006708094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]