SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386641418|ref|YP_006108216.1| from Escherichia coli ABU 83972

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386641418|ref|YP_006108216.1|
Domain Number 1 Region: 114-395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.81e-68
Family RecA protein-like (ATPase-domain) 0.00000000186
Further Details:      
 
Domain Number 2 Region: 72-149
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.31e-29
Family Cold shock DNA-binding domain-like 0.0000102
Further Details:      
 
Domain Number 3 Region: 25-70
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000000000022
Family Rho termination factor, N-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386641418|ref|YP_006108216.1|
Sequence length 443
Comment transcription termination factor Rho [Escherichia coli ABU 83972]
Sequence
MDDPAIPFTTLSSRFTPSLRTHTTMNLTELKNTPVSELITLGENMGLENLARMRKQDIIF
AILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDT
ISGKIRPPKEGERYFALLKVNEVNFDKPENARNKILFENLTPLHANSRLRMERGNGSTED
LTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEV
TEMQRLVKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNT
VVPASGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFK
GTGNMELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAM
EFLINKLAMTKTNDDFFEMMKRS
Download sequence
Identical sequences A0A090NWN2 A0A0A0F7L2 A0A0A0GPI6 A0A0A7A1T9 A0A0F6MJS1 A0A0H2Z4W7 A0A0H3EP52 A0A0I1X139 A0A192CF37 A0A1X3HZH2 A0A1X3IU74 A0A1X3J9W5 A0A1X3K2W8 A0A1X3KW26 D2ABV2 F4NQH7 F4SRI8 F4T630 F4TMM7 F4V8A5 F4VLA6 Q0SYX2 Q1R4F5 W8ZR94
YP_006122099.1.29421 gi|26250521|ref|NP_756561.1| gi|560159916|ref|YP_008852631.1| gi|91213304|ref|YP_543290.1| gi|386636640|ref|YP_006156359.1| gi|387831675|ref|YP_003351612.1| gi|384545385|ref|YP_005729449.1| gi|386631720|ref|YP_006151440.1| gi|386641418|ref|YP_006108216.1| 199310.c4702 362663.ECP_3974 364106.UTI89_C4338 373384.SFV_3722 405955.APECO1_2691 gi|387619077|ref|YP_006122099.1| gi|110807528|ref|YP_691048.1| gi|117626043|ref|YP_859366.1| gi|110644109|ref|YP_671839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]