SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|251785473|ref|YP_002999777.1| from Escherichia coli BL21(DE3)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|251785473|ref|YP_002999777.1|
Domain Number 1 Region: 3-326
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.22e-68
Family ADP-ribosylglycohydrolase 0.000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|251785473|ref|YP_002999777.1|
Sequence length 334
Comment hydrolase [Escherichia coli BL21(DE3)]
Sequence
MKTERILGALYGQALGDAMGMPSELWPRSRVKAHFGWIDRFLPGPKENNAACYFNRAEFT
DDTSMALCLADALLERKGKIDPDLIGRNILDWALRFDAFNKNVLGPTSKIALNAIRDGKP
VAELENNGVTNGAAMRVSPLGCLLPARDVDSFIDDVALASSPTHKSDLAVAGAVVIAWAI
SRAIDGESWSAIVDSLPSIARHAQQKRITTFSASLAARLEIALKIVRNADGTESASEQLY
QVVGAGTSTIESVPCAIALVELAQTDPNRCAVLCANLGGDTDTIGAMATAICGALHGVNA
IDPALKAELDAVNQLDFNRYATALAKYRQQREAV
Download sequence
Identical sequences A0A0Q3FGG7 A0A140N7M4 A0A142H4B5 A0A236LHZ9 E3XQ72 H4ICZ0 H4ITR6 H4J9X1 H4KIR6 H4LDR2 W1B288
gi|251785473|ref|YP_002999777.1| WP_000846243.1.100950 WP_000846243.1.101186 WP_000846243.1.101908 WP_000846243.1.10491 WP_000846243.1.1058 WP_000846243.1.10787 WP_000846243.1.12060 WP_000846243.1.12675 WP_000846243.1.13002 WP_000846243.1.15869 WP_000846243.1.17360 WP_000846243.1.18588 WP_000846243.1.19465 WP_000846243.1.1982 WP_000846243.1.20170 WP_000846243.1.20737 WP_000846243.1.2089 WP_000846243.1.21017 WP_000846243.1.21020 WP_000846243.1.22543 WP_000846243.1.22885 WP_000846243.1.24316 WP_000846243.1.24362 WP_000846243.1.24909 WP_000846243.1.25312 WP_000846243.1.25372 WP_000846243.1.2712 WP_000846243.1.27611 WP_000846243.1.28480 WP_000846243.1.29341 WP_000846243.1.30691 WP_000846243.1.31506 WP_000846243.1.32587 WP_000846243.1.34993 WP_000846243.1.35704 WP_000846243.1.36739 WP_000846243.1.36833 WP_000846243.1.38155 WP_000846243.1.39167 WP_000846243.1.41813 WP_000846243.1.42209 WP_000846243.1.42258 WP_000846243.1.46573 WP_000846243.1.47764 WP_000846243.1.48847 WP_000846243.1.51380 WP_000846243.1.51548 WP_000846243.1.52421 WP_000846243.1.52844 WP_000846243.1.54476 WP_000846243.1.56197 WP_000846243.1.56285 WP_000846243.1.5787 WP_000846243.1.58429 WP_000846243.1.59793 WP_000846243.1.59900 WP_000846243.1.59912 WP_000846243.1.61617 WP_000846243.1.64448 WP_000846243.1.66280 WP_000846243.1.67200 WP_000846243.1.67553 WP_000846243.1.69261 WP_000846243.1.6945 WP_000846243.1.69735 WP_000846243.1.71632 WP_000846243.1.71690 WP_000846243.1.71938 WP_000846243.1.76184 WP_000846243.1.76643 WP_000846243.1.76948 WP_000846243.1.77471 WP_000846243.1.78007 WP_000846243.1.78791 WP_000846243.1.79306 WP_000846243.1.81576 WP_000846243.1.81723 WP_000846243.1.83347 WP_000846243.1.8345 WP_000846243.1.84877 WP_000846243.1.87990 WP_000846243.1.88711 WP_000846243.1.89977 WP_000846243.1.91994 WP_000846243.1.93048 WP_000846243.1.93312 WP_000846243.1.93971 WP_000846243.1.94686 WP_000846243.1.94847 WP_000846243.1.95521 WP_000846243.1.96279 WP_000846243.1.97437 gi|253772972|ref|YP_003035803.1| gi|254162112|ref|YP_003045220.1| gi|251785473|ref|YP_002999777.1| 413997.ECB_02027 469008.ECBD_1558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]