SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386635889|ref|YP_006155608.1| from Escherichia coli str. 'clone D i14'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386635889|ref|YP_006155608.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.27e-109
Family FMN-linked oxidoreductases 0.0000000000109
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 9.89e-42
Family N-terminal domain of adrenodoxin reductase-like 0.000000324
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.37e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386635889|ref|YP_006155608.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Escherichia coli str. 'clone D i14']
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEGGGTFAEMVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETQRYYRRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPN
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A0H2VB00 A0A234U5B5
gi|26249670|ref|NP_755710.1| 199310.c3839 gi|386630969|ref|YP_006150689.1| gi|386640695|ref|YP_006107493.1| gi|386635889|ref|YP_006155608.1| WP_000121468.1.100306 WP_000121468.1.10138 WP_000121468.1.101693 WP_000121468.1.101700 WP_000121468.1.101984 WP_000121468.1.102076 WP_000121468.1.102106 WP_000121468.1.10786 WP_000121468.1.10869 WP_000121468.1.11285 WP_000121468.1.11411 WP_000121468.1.11575 WP_000121468.1.12268 WP_000121468.1.12295 WP_000121468.1.1278 WP_000121468.1.12826 WP_000121468.1.13272 WP_000121468.1.13626 WP_000121468.1.13778 WP_000121468.1.14245 WP_000121468.1.14371 WP_000121468.1.16705 WP_000121468.1.17325 WP_000121468.1.17849 WP_000121468.1.18908 WP_000121468.1.19036 WP_000121468.1.19171 WP_000121468.1.1960 WP_000121468.1.19761 WP_000121468.1.19972 WP_000121468.1.20962 WP_000121468.1.21614 WP_000121468.1.22088 WP_000121468.1.22293 WP_000121468.1.22667 WP_000121468.1.23282 WP_000121468.1.23700 WP_000121468.1.24177 WP_000121468.1.24797 WP_000121468.1.25612 WP_000121468.1.26284 WP_000121468.1.26398 WP_000121468.1.26579 WP_000121468.1.26837 WP_000121468.1.2700 WP_000121468.1.27871 WP_000121468.1.28345 WP_000121468.1.28723 WP_000121468.1.29258 WP_000121468.1.2963 WP_000121468.1.29647 WP_000121468.1.29819 WP_000121468.1.29855 WP_000121468.1.30400 WP_000121468.1.309 WP_000121468.1.32478 WP_000121468.1.32748 WP_000121468.1.34208 WP_000121468.1.34362 WP_000121468.1.35107 WP_000121468.1.35394 WP_000121468.1.35578 WP_000121468.1.35741 WP_000121468.1.35889 WP_000121468.1.36459 WP_000121468.1.37032 WP_000121468.1.37477 WP_000121468.1.39313 WP_000121468.1.39651 WP_000121468.1.39734 WP_000121468.1.40349 WP_000121468.1.40486 WP_000121468.1.40843 WP_000121468.1.41041 WP_000121468.1.41063 WP_000121468.1.41078 WP_000121468.1.41332 WP_000121468.1.42600 WP_000121468.1.43427 WP_000121468.1.44327 WP_000121468.1.4459 WP_000121468.1.44717 WP_000121468.1.45190 WP_000121468.1.45525 WP_000121468.1.45789 WP_000121468.1.45891 WP_000121468.1.46438 WP_000121468.1.46795 WP_000121468.1.47047 WP_000121468.1.47189 WP_000121468.1.47235 WP_000121468.1.47366 WP_000121468.1.47454 WP_000121468.1.48431 WP_000121468.1.49170 WP_000121468.1.49179 WP_000121468.1.49483 WP_000121468.1.50228 WP_000121468.1.51426 WP_000121468.1.52085 WP_000121468.1.53021 WP_000121468.1.54188 WP_000121468.1.54208 WP_000121468.1.5434 WP_000121468.1.54534 WP_000121468.1.54590 WP_000121468.1.54754 WP_000121468.1.5478 WP_000121468.1.55731 WP_000121468.1.55790 WP_000121468.1.55808 WP_000121468.1.56122 WP_000121468.1.56941 WP_000121468.1.57608 WP_000121468.1.57832 WP_000121468.1.58233 WP_000121468.1.59060 WP_000121468.1.59483 WP_000121468.1.59815 WP_000121468.1.59970 WP_000121468.1.615 WP_000121468.1.62091 WP_000121468.1.62586 WP_000121468.1.63310 WP_000121468.1.63419 WP_000121468.1.63465 WP_000121468.1.64180 WP_000121468.1.643 WP_000121468.1.6500 WP_000121468.1.65104 WP_000121468.1.6527 WP_000121468.1.65957 WP_000121468.1.6666 WP_000121468.1.66706 WP_000121468.1.67164 WP_000121468.1.68052 WP_000121468.1.69382 WP_000121468.1.69450 WP_000121468.1.697 WP_000121468.1.69832 WP_000121468.1.69963 WP_000121468.1.701 WP_000121468.1.7015 WP_000121468.1.70230 WP_000121468.1.71287 WP_000121468.1.71967 WP_000121468.1.72117 WP_000121468.1.723 WP_000121468.1.72425 WP_000121468.1.72599 WP_000121468.1.74032 WP_000121468.1.74041 WP_000121468.1.74915 WP_000121468.1.75118 WP_000121468.1.76268 WP_000121468.1.76269 WP_000121468.1.76504 WP_000121468.1.76660 WP_000121468.1.76961 WP_000121468.1.77036 WP_000121468.1.77643 WP_000121468.1.77816 WP_000121468.1.78232 WP_000121468.1.78512 WP_000121468.1.78689 WP_000121468.1.79001 WP_000121468.1.79100 WP_000121468.1.79409 WP_000121468.1.80063 WP_000121468.1.80660 WP_000121468.1.80948 WP_000121468.1.81098 WP_000121468.1.81266 WP_000121468.1.814 WP_000121468.1.82104 WP_000121468.1.82221 WP_000121468.1.83256 WP_000121468.1.83644 WP_000121468.1.85025 WP_000121468.1.85252 WP_000121468.1.85578 WP_000121468.1.85593 WP_000121468.1.86273 WP_000121468.1.8656 WP_000121468.1.86560 WP_000121468.1.86613 WP_000121468.1.87766 WP_000121468.1.88082 WP_000121468.1.88767 WP_000121468.1.88793 WP_000121468.1.88826 WP_000121468.1.89043 WP_000121468.1.89285 WP_000121468.1.89396 WP_000121468.1.89469 WP_000121468.1.902 WP_000121468.1.90357 WP_000121468.1.90905 WP_000121468.1.90996 WP_000121468.1.91566 WP_000121468.1.91756 WP_000121468.1.9209 WP_000121468.1.92767 WP_000121468.1.93139 WP_000121468.1.93461 WP_000121468.1.93765 WP_000121468.1.94040 WP_000121468.1.9474 WP_000121468.1.94869 WP_000121468.1.95084 WP_000121468.1.95398 WP_000121468.1.95628 WP_000121468.1.96558 WP_000121468.1.96762 WP_000121468.1.97292 WP_000121468.1.99060 WP_000121468.1.99571 WP_000121468.1.99694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]