SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for fid|94010273|locus|VBIPseFlu147482_0148| from Pseudomonas fluorescens R124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  fid|94010273|locus|VBIPseFlu147482_0148|
Domain Number 1 Region: 101-167
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000196
Family NfeD domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) fid|94010273|locus|VBIPseFlu147482_0148|
Sequence length 176
Comment Putative membrane-bound ClpP-class protease associated with aq_911 [Pseudomonas fluorescens R124]
Sequence
MTSRCCTFFLMLLLSGSALAADVPLTAVNPVGLWLITLGIAFLIAEAALPNYGVIGLGGI
IMFVIGALILSNADLPVPMMIGLGLISALLLIALIIRALKTRPRHAVSGDAGLVGSVTAV
TTVQAENTHNGWVQLQGEHWQVQSTTPLHTGQSVRVVGRKGLLLKVAATDAAGHGE
Download sequence
Identical sequences fid|94010273|locus|VBIPseFlu147482_0148|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]