SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for fid|94015241|locus|VBIPseFlu147482_2576| from Pseudomonas fluorescens R124

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  fid|94015241|locus|VBIPseFlu147482_2576|
Domain Number - Region: 150-223
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0251
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.029
Further Details:      
 
Domain Number - Region: 64-104
Classification Level Classification E-value
Superfamily Photosystem I reaction center subunit XI, PsaL 0.0667
Family Photosystem I reaction center subunit XI, PsaL 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) fid|94015241|locus|VBIPseFlu147482_2576|
Sequence length 259
Comment Membrane protein, putative [Pseudomonas fluorescens R124]
Sequence
MPFELSVDLTTLAILALVAFIAGFIDAIAGGGGLLTTPALLTAGLPPHLVLGTNKLSSTF
GSATASFTFYRRKLFHPRQWMHAIVGTLVGALTGAIVAHYLPAEWLNKMLPVIVFACGLY
LLFGGTPKAPLDSDAPIKKKWQSTQGFSLGFYDGVAGPGTGAFWTVSSLLLYPIDLVKAS
GVARSMNFVSNIAALSVFVFSGQVDWIIGLSMGLSVMVGAFFGARTAISGGAKFIRPVFI
TVVLGLTVRLAWQHWFSVA
Download sequence
Identical sequences K0WJ47
WP_003224680.1.32813 fid|94015241|locus|VBIPseFlu147482_2576|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]