SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for fid|94015584|locus|VBIPseFlu147482_2745| from Pseudomonas fluorescens R124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  fid|94015584|locus|VBIPseFlu147482_2745|
Domain Number 1 Region: 4-208
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.47e-51
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) fid|94015584|locus|VBIPseFlu147482_2745|
Sequence length 221
Comment Formate dehydrogenase N gamma subunit (EC 1.2.1.2) [Pseudomonas fluorescens R124]
Sequence
MSNKTILRYTANQRTNHWLVAILFFMAGLSGLALFHPSMFWLTHLFGGGPWTRILHPFMG
VLMFVLFLGLVFRFWRANFFIDNDWKWMRRIDRVLVNDEESVPPVGKYNAGQKMLFWTLL
LCMLGLLFTGLVIWRAYFSAYFGITVIRWAMLLHALAGFVLILSIIVHIYAGLWIKGSVD
AMLHGWVSRAWARKHHELWYRDITRDERNPDVPERPITKKG
Download sequence
Identical sequences A0A2C5W489 A0A2K4GVL7 A0A2K4IB89 K0WJI3
fid|94015584|locus|VBIPseFlu147482_2745| WP_003224974.1.32813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]