SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for fid|94016754|locus|VBIPseFlu147482_3319| from Pseudomonas fluorescens R124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  fid|94016754|locus|VBIPseFlu147482_3319|
Domain Number 1 Region: 6-181
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.26e-27
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) fid|94016754|locus|VBIPseFlu147482_3319|
Sequence length 182
Comment Cytochrome b561 [Pseudomonas fluorescens R124]
Sequence
MTRDTAVTRYGKLSITLHWLMLALFVGVYACVEIKGFMPKGSEARGLLMGFHGLFGTSIF
VLVWVRLLGRLSPRPPITPKPPAWQTGISHLMHLALYGLMIATPILAWLMLAAADKPFPY
FGFHVPAPVAIDPDFAKQLKYWHETLGSAGYWLIGLHAAAGLFHHYWVRDNTLVRMLPGR
TE
Download sequence
Identical sequences K0WGT9
WP_003226011.1.32813 fid|94016754|locus|VBIPseFlu147482_3319|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]