SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for fid|94019136|locus|VBIPseFlu147482_4468| from Pseudomonas fluorescens R124

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  fid|94019136|locus|VBIPseFlu147482_4468|
Domain Number 1 Region: 6-278
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 5.02e-95
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000401
Further Details:      
 
Domain Number 2 Region: 280-396
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 2.14e-34
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) fid|94019136|locus|VBIPseFlu147482_4468|
Sequence length 403
Comment Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2) [Pseudomonas fluorescens R124]
Sequence
MSKFMDWVDARFPATKMWEDHLSKYYAPKNFNFFYFFGSLALLVLVNQIVTGVWLTMSYT
PSAEEAFASVEYIMRDVEYGSILRLLHSTGASAFFIVVYLHMFRGLLYGSYQKPRELVWV
FGMLIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGNDLTQWIRGDYLISGIT
LNRFFALHVVALPIVILGLVVLHILALHEVGSNNPDGVDIKKHKDENGIPLDGIAFHPYY
TVKDIVGVVVFLFIFCFIVFFFPEMGGYFLEKPNFEQANPFKTPEHIAPVWYFTPFYAIL
RAIPDKLMGVIAMGASIALLFVLPWLDRSPVKSMRYKGWMSKVWLLVFCVAFVILGILGV
LAPTPERTLISQVCTFLYFAYFILMPFYTRLEKTKPVPERVTG
Download sequence
Identical sequences K0WP76
WP_003228050.1.32813 fid|94019136|locus|VBIPseFlu147482_4468|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]