SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for fid|94020227|locus|VBIPseFlu147482_4987| from Pseudomonas fluorescens R124

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  fid|94020227|locus|VBIPseFlu147482_4987|
Domain Number - Region: 151-216
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0366
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) fid|94020227|locus|VBIPseFlu147482_4987|
Sequence length 374
Comment putative iron-regulated membrane protein [Pseudomonas fluorescens R124]
Sequence
MKSKTIRRWSFIHTWTSLICTVFLLLLALTGLPLIFHHEIEHLLGDAPQVREMPADTPRL
NLAQLVDAAEKHRPGEVVQYFGFEDDEPNAVLTIMAKTAGTEPNSSHTFMLDARTGEALE
TPSANGGLMLFILRLHVDMFAGLPGKLLLAFMGLLFVVAIISGTVLYLPFMRRLPFGTVR
QDKSTRLRWLDLHNLIGIVTLTWALVVGVTGVISACADLIIAAWRNDTLTAMVAPYRDAP
PLTRLAPATRLLDIARDVAPGMNPDFIAFPGTRFSSEHHYSVFMKGGTHLTSHLLTPVLI
DASTLQVTAVGERPWYMDAMGMSQPLHFGDYGGMPMKILWATLDVLTIIVLGSGVYLWVV
RRKAAKPVTAEAAA
Download sequence
Identical sequences K0WQF5
WP_003228935.1.32813 fid|94020227|locus|VBIPseFlu147482_4987|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]