SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387620474|ref|YP_006128101.1| from Escherichia coli DH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387620474|ref|YP_006128101.1|
Domain Number 1 Region: 155-428
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 7.98e-56
Family Tricorn protease N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 29-161
Classification Level Classification E-value
Superfamily TolB, N-terminal domain 4.84e-40
Family TolB, N-terminal domain 0.000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387620474|ref|YP_006128101.1|
Sequence length 430
Comment tolB [Escherichia coli DH1]
Sequence
MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAA
DLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVD
TGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPY
ELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVA
SFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQ
NLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAK
QDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQ
VKFPAWSPYL
Download sequence
Identical sequences A0A023YUE5 A0A024KR74 A0A025CFJ1 A0A026V336 A0A027TY52 A0A028AGP1 A0A028DMK2 A0A029I9E5 A0A029IYW8 A0A062Y378 A0A064TWJ4 A0A070F3V6 A0A070UKB7 A0A073GBX6 A0A074I9E5 A0A080GAX7 A0A080JCX5 A0A0A0F9G1 A0A0A8UAI7 A0A0E0TV46 A0A0E0V292 A0A0E0Y2D6 A0A0E1LZ85 A0A0E1T5V1 A0A0E2LMS3 A0A0F6C0P6 A0A0F6F2U5 A0A0H3EGL3 A0A0H3PPH9 A0A0H9UZS2 A0A0K9TEN3 A0A0M9J8S7 A0A125X755 A0A127GHQ8 A0A140NEI9 A0A142H0R7 A0A168UEE2 A0A1E2VGI0 A0A1S6T8J2 A0A1W2N370 A0A1X3I8M7 A0A1X3J4D1 A0A1X3JK31 A0A1X3L3Z9 A0A1X3LGP8 A0A1Z3UTA2 A0A222QGU4 A0A237F8P9 A0A2D0NMV9 A0A2H1BKD5 A7ZJC2 B1IXY9 B1X6S1 B5YRE4 B7LAE7 B7MFZ3 B7MPN1 B7N9Y9 B7NMV9 B7ULM0 C3TIH2 C4ZWL5 C8U3X6 C8UK39 D2A9D9 D3GY88 D6HUB2 D6I6W7 D6J861 E0J6E7 E3PHC9 E3XJ72 E7T0X1 E9XNR8 E9YRV4 F3WFI0 F4SL32 F4SWU9 F4TBV4 F4VBH1 F5MYV0 F5NQR2 G0FF26 H4I845 H4INM0 H4J466 H4KDL9 H4L908 H4UGX3 I2RAU9 I2UMH1 I2WSF6 I4SM07 J7QYX5 K4VHK2 K4X2P0 L2V778 L2XTY2 L3BQQ2 L3PCC0 L3QCT1 L3QQW4 L4JFQ5 L4W047 M9GA35 P0A855 P0A856 P0A857 Q0TJV4 Q1REI5 Q3Z464 S0VYI3 S0XYT7 S0ZJY3 S1DEV4 S1ETH5 S1HG65 S1I4G8 S1IGW1 S1PL24 T6AZ87 T6IC14 T6N0G3 T9AJ92 T9EVR8 V2RES4 V2TSN1 V6G190 V8F9C1 V8KVC2 W1AWJ8 W1ER30
gi|471332802|ref|YP_007556279.1| gi|251784229|ref|YP_002998533.1| gi|386612908|ref|YP_006132574.1| 155864.Z0908 198215.S0570 300269.SSON_0692 316385.ECDH10B_0807 316407.tolB 331111.EcE24377A_0769 362663.ECP_0751 386585.ECs0775 413997.ECB_00700 444450.ECH74115_0843 469008.ECBD_2920 481805.EcolC_2915 511145.b0740 544404.ECSP_0793 573235.ECO26_0801 574521.E2348C_0624 585035.ECS88_0763 585055.EC55989_0725 585056.ECUMN_0828 585057.ECIAI39_0715 585395.ECO103_0735 585396.ECO111_0757 585397.ECED1_0707 595496.BWG_0599 gi|387620474|ref|YP_006128101.1| gi|251784229|ref|YP_002998533.1| gi|157154962|ref|YP_001461901.1| gi|386708508|ref|YP_006172229.1| gi|74311264|ref|YP_309683.1| gi|218699112|ref|YP_002406741.1| gi|15830029|ref|NP_308802.1| gi|387620474|ref|YP_006128101.1| gi|260853975|ref|YP_003227866.1| gi|218688531|ref|YP_002396743.1| gi|15800456|ref|NP_286468.1| gi|238900005|ref|YP_002925801.1| gi|209399861|ref|YP_002269374.1| gi|387611226|ref|YP_006114342.1| gi|386598463|ref|YP_006099969.1| gi|407468156|ref|YP_006785402.1| gi|386708508|ref|YP_006172229.1| gi|407483112|ref|YP_006780261.1| gi|110640948|ref|YP_668676.1| gi|387606227|ref|YP_006095083.1| gi|254160810|ref|YP_003043918.1| gi|260842946|ref|YP_003220724.1| gi|384542159|ref|YP_005726221.1| gi|383177313|ref|YP_005455318.1| gi|544575132|ref|YP_008570656.1| gi|443616765|ref|YP_007380621.1| gi|170080407|ref|YP_001729727.1| gi|218694164|ref|YP_002401831.1| gi|386623132|ref|YP_006142860.1| gi|218704067|ref|YP_002411586.1| gi|410483665|ref|YP_006771211.1| gi|378713896|ref|YP_005278789.1| gi|556550824|ref|YP_008720785.1| gi|260866871|ref|YP_003233273.1| gi|387828726|ref|YP_003348663.1| gi|254791897|ref|YP_003076734.1| gi|170020915|ref|YP_001725869.1| gi|30062097|ref|NP_836268.1| gi|544389511|ref|YP_008563913.1| gi|387881310|ref|YP_006311612.1| gi|386618193|ref|YP_006137773.1| gi|386638099|ref|YP_006104897.1| gi|218557653|ref|YP_002390566.1| NP_308802.1.58667 NP_415268.1.90541 WP_001295307.1.1000 WP_001295307.1.10001 WP_001295307.1.100014 WP_001295307.1.100044 WP_001295307.1.100052 WP_001295307.1.100063 WP_001295307.1.100066 WP_001295307.1.100073 WP_001295307.1.100085 WP_001295307.1.10010 WP_001295307.1.100111 WP_001295307.1.100138 WP_001295307.1.100151 WP_001295307.1.100159 WP_001295307.1.100185 WP_001295307.1.100194 WP_001295307.1.100220 WP_001295307.1.100227 WP_001295307.1.100251 WP_001295307.1.100252 WP_001295307.1.100281 WP_001295307.1.100283 WP_001295307.1.100285 WP_001295307.1.100299 WP_001295307.1.100302 WP_001295307.1.100304 WP_001295307.1.100306 WP_001295307.1.10034 WP_001295307.1.100346 WP_001295307.1.100389 WP_001295307.1.100425 WP_001295307.1.100441 WP_001295307.1.100444 WP_001295307.1.100448 WP_001295307.1.100451 WP_001295307.1.100474 WP_001295307.1.10048 WP_001295307.1.100487 WP_001295307.1.100496 WP_001295307.1.100499 WP_001295307.1.100508 WP_001295307.1.10051 WP_001295307.1.100531 WP_001295307.1.100543 WP_001295307.1.100554 WP_001295307.1.100571 WP_001295307.1.100573 WP_001295307.1.100614 WP_001295307.1.100667 WP_001295307.1.10067 WP_001295307.1.10068 WP_001295307.1.100685 WP_001295307.1.100689 WP_001295307.1.100725 WP_001295307.1.100735 WP_001295307.1.100738 WP_001295307.1.100752 WP_001295307.1.100758 WP_001295307.1.100778 WP_001295307.1.100796 WP_001295307.1.10080 WP_001295307.1.100803 WP_001295307.1.100824 WP_001295307.1.100851 WP_001295307.1.100852 WP_001295307.1.10086 WP_001295307.1.100867 WP_001295307.1.100868 WP_001295307.1.100898 WP_001295307.1.100916 WP_001295307.1.100925 WP_001295307.1.100933 WP_001295307.1.10094 WP_001295307.1.100950 WP_001295307.1.100959 WP_001295307.1.100990 WP_001295307.1.10100 WP_001295307.1.101033 WP_001295307.1.101052 WP_001295307.1.101087 WP_001295307.1.101096 WP_001295307.1.1011 WP_001295307.1.101102 WP_001295307.1.101105 WP_001295307.1.101110 WP_001295307.1.101121 WP_001295307.1.101148 WP_001295307.1.101152 WP_001295307.1.101157 WP_001295307.1.101158 WP_001295307.1.101166 WP_001295307.1.101175 WP_001295307.1.101186 WP_001295307.1.101206 WP_001295307.1.101214 WP_001295307.1.101216 WP_001295307.1.101255 WP_001295307.1.101257 WP_001295307.1.10126 WP_001295307.1.101282 WP_001295307.1.101289 WP_001295307.1.101293 WP_001295307.1.10131 WP_001295307.1.101313 WP_001295307.1.101359 WP_001295307.1.101387 WP_001295307.1.101399 WP_001295307.1.101418 WP_001295307.1.101423 WP_001295307.1.101429 WP_001295307.1.101430 WP_001295307.1.101436 WP_001295307.1.101439 WP_001295307.1.101445 WP_001295307.1.101468 WP_001295307.1.101486 WP_001295307.1.101518 WP_001295307.1.101522 WP_001295307.1.10154 WP_001295307.1.101545 WP_001295307.1.101583 WP_001295307.1.101586 WP_001295307.1.101594 WP_001295307.1.101628 WP_001295307.1.101630 WP_001295307.1.101651 WP_001295307.1.101653 WP_001295307.1.101667 WP_001295307.1.101668 WP_001295307.1.101686 WP_001295307.1.101693 WP_001295307.1.101694 WP_001295307.1.101700 WP_001295307.1.101727 WP_001295307.1.10173 WP_001295307.1.101737 WP_001295307.1.101747 WP_001295307.1.101769 WP_001295307.1.101777 WP_001295307.1.101786 WP_001295307.1.10181 WP_001295307.1.101822 WP_001295307.1.10184 WP_001295307.1.101840 WP_001295307.1.101845 WP_001295307.1.101855 WP_001295307.1.101865 WP_001295307.1.10187 WP_001295307.1.10188 WP_001295307.1.101887 WP_001295307.1.101889 WP_001295307.1.101900 WP_001295307.1.101908 WP_001295307.1.101913 WP_001295307.1.101926 WP_001295307.1.101932 WP_001295307.1.101937 WP_001295307.1.101940 WP_001295307.1.101942 WP_001295307.1.101948 WP_001295307.1.101952 WP_001295307.1.101962 WP_001295307.1.101964 WP_001295307.1.101969 WP_001295307.1.101984 WP_001295307.1.101987 WP_001295307.1.102021 WP_001295307.1.102036 WP_001295307.1.102069 WP_001295307.1.102076 WP_001295307.1.102093 WP_001295307.1.102094 WP_001295307.1.102104 WP_001295307.1.102106 WP_001295307.1.102122 WP_001295307.1.102144 WP_001295307.1.10222 WP_001295307.1.10226 WP_001295307.1.10233 WP_001295307.1.10235 WP_001295307.1.10252 WP_001295307.1.10273 WP_001295307.1.10304 WP_001295307.1.10326 WP_001295307.1.10329 WP_001295307.1.10335 WP_001295307.1.10348 WP_001295307.1.10352 WP_001295307.1.10361 WP_001295307.1.10379 WP_001295307.1.1040 WP_001295307.1.10400 WP_001295307.1.10417 WP_001295307.1.10461 WP_001295307.1.10491 WP_001295307.1.10492 WP_001295307.1.10496 WP_001295307.1.10524 WP_001295307.1.10525 WP_001295307.1.10538 WP_001295307.1.10569 WP_001295307.1.10573 WP_001295307.1.10576 WP_001295307.1.10579 WP_001295307.1.1058 WP_001295307.1.10605 WP_001295307.1.10607 WP_001295307.1.10628 WP_001295307.1.10651 WP_001295307.1.10673 WP_001295307.1.10697 WP_001295307.1.10705 WP_001295307.1.1071 WP_001295307.1.10715 WP_001295307.1.10729 WP_001295307.1.1073 WP_001295307.1.1074 WP_001295307.1.10744 WP_001295307.1.10748 WP_001295307.1.10761 WP_001295307.1.10763 WP_001295307.1.10771 WP_001295307.1.10786 WP_001295307.1.10787 WP_001295307.1.10798 WP_001295307.1.10809 WP_001295307.1.10814 WP_001295307.1.10824 WP_001295307.1.10833 WP_001295307.1.10842 WP_001295307.1.10849 WP_001295307.1.10862 WP_001295307.1.10869 WP_001295307.1.10922 WP_001295307.1.10940 WP_001295307.1.10970 WP_001295307.1.10988 WP_001295307.1.10989 WP_001295307.1.10994 WP_001295307.1.10995 WP_001295307.1.11006 WP_001295307.1.11032 WP_001295307.1.11047 WP_001295307.1.11052 WP_001295307.1.11057 WP_001295307.1.11068 WP_001295307.1.11091 WP_001295307.1.1111 WP_001295307.1.11113 WP_001295307.1.11118 WP_001295307.1.11121 WP_001295307.1.1113 WP_001295307.1.11133 WP_001295307.1.112 WP_001295307.1.11217 WP_001295307.1.1122 WP_001295307.1.11240 WP_001295307.1.11241 WP_001295307.1.11250 WP_001295307.1.11251 WP_001295307.1.11265 WP_001295307.1.11272 WP_001295307.1.11285 WP_001295307.1.11301 WP_001295307.1.11315 WP_001295307.1.11323 WP_001295307.1.11399 WP_001295307.1.11408 WP_001295307.1.11411 WP_001295307.1.11418 WP_001295307.1.11420 WP_001295307.1.11436 WP_001295307.1.11437 WP_001295307.1.11440 WP_001295307.1.11452 WP_001295307.1.11467 WP_001295307.1.11499 WP_001295307.1.11519 WP_001295307.1.11524 WP_001295307.1.11531 WP_001295307.1.11542 WP_001295307.1.11575 WP_001295307.1.11578 WP_001295307.1.11595 WP_001295307.1.11607 WP_001295307.1.11608 WP_001295307.1.11612 WP_001295307.1.11616 WP_001295307.1.11645 WP_001295307.1.11671 WP_001295307.1.11673 WP_001295307.1.1168 WP_001295307.1.11690 WP_001295307.1.11699 WP_001295307.1.11748 WP_001295307.1.11759 WP_001295307.1.1176 WP_001295307.1.11762 WP_001295307.1.11801 WP_001295307.1.11803 WP_001295307.1.11844 WP_001295307.1.1186 WP_001295307.1.11912 WP_001295307.1.11949 WP_001295307.1.11955 WP_001295307.1.11956 WP_001295307.1.1196 WP_001295307.1.11981 WP_001295307.1.11982 WP_001295307.1.11985 WP_001295307.1.12000 WP_001295307.1.12009 WP_001295307.1.12010 WP_001295307.1.12030 WP_001295307.1.12036 WP_001295307.1.12050 WP_001295307.1.12051 WP_001295307.1.12060 WP_001295307.1.12076 WP_001295307.1.12088 WP_001295307.1.12095 WP_001295307.1.12111 WP_001295307.1.12112 WP_001295307.1.12115 WP_001295307.1.1212 WP_001295307.1.12151 WP_001295307.1.12157 WP_001295307.1.1218 WP_001295307.1.12204 WP_001295307.1.12230 WP_001295307.1.12268 WP_001295307.1.12279 WP_001295307.1.12292 WP_001295307.1.12295 WP_001295307.1.12305 WP_001295307.1.12319 WP_001295307.1.12320 WP_001295307.1.12342 WP_001295307.1.12344 WP_001295307.1.12415 WP_001295307.1.1242 WP_001295307.1.12426 WP_001295307.1.12458 WP_001295307.1.12459 WP_001295307.1.12468 WP_001295307.1.12478 WP_001295307.1.12542 WP_001295307.1.12552 WP_001295307.1.12558 WP_001295307.1.12566 WP_001295307.1.12574 WP_001295307.1.12582 WP_001295307.1.12594 WP_001295307.1.12623 WP_001295307.1.12645 WP_001295307.1.12646 WP_001295307.1.12675 WP_001295307.1.12679 WP_001295307.1.12680 WP_001295307.1.12693 WP_001295307.1.12697 WP_001295307.1.127 WP_001295307.1.12709 WP_001295307.1.12717 WP_001295307.1.12743 WP_001295307.1.12749 WP_001295307.1.1275 WP_001295307.1.12756 WP_001295307.1.12761 WP_001295307.1.12762 WP_001295307.1.12763 WP_001295307.1.12766 WP_001295307.1.12775 WP_001295307.1.1278 WP_001295307.1.12781 WP_001295307.1.1280 WP_001295307.1.12826 WP_001295307.1.12830 WP_001295307.1.12831 WP_001295307.1.12876 WP_001295307.1.12893 WP_001295307.1.12911 WP_001295307.1.12914 WP_001295307.1.12915 WP_001295307.1.12917 WP_001295307.1.12944 WP_001295307.1.1295 WP_001295307.1.12956 WP_001295307.1.12965 WP_001295307.1.12976 WP_001295307.1.12979 WP_001295307.1.12987 WP_001295307.1.12991 WP_001295307.1.13002 WP_001295307.1.13031 WP_001295307.1.13060 WP_001295307.1.13074 WP_001295307.1.1308 WP_001295307.1.13117 WP_001295307.1.1312 WP_001295307.1.13136 WP_001295307.1.1314 WP_001295307.1.1315 WP_001295307.1.13157 WP_001295307.1.13162 WP_001295307.1.13176 WP_001295307.1.13181 WP_001295307.1.13205 WP_001295307.1.13217 WP_001295307.1.13222 WP_001295307.1.13223 WP_001295307.1.1323 WP_001295307.1.13239 WP_001295307.1.13252 WP_001295307.1.13258 WP_001295307.1.13271 WP_001295307.1.13272 WP_001295307.1.13278 WP_001295307.1.13290 WP_001295307.1.13295 WP_001295307.1.13301 WP_001295307.1.13332 WP_001295307.1.13333 WP_001295307.1.13346 WP_001295307.1.13348 WP_001295307.1.1335 WP_001295307.1.13383 WP_001295307.1.13393 WP_001295307.1.13409 WP_001295307.1.13411 WP_001295307.1.1343 WP_001295307.1.13430 WP_001295307.1.13437 WP_001295307.1.13442 WP_001295307.1.1345 WP_001295307.1.13451 WP_001295307.1.13469 WP_001295307.1.13473 WP_001295307.1.13492 WP_001295307.1.13495 WP_001295307.1.13525 WP_001295307.1.13566 WP_001295307.1.13585 WP_001295307.1.13589 WP_001295307.1.13600 WP_001295307.1.13601 WP_001295307.1.13608 WP_001295307.1.13618 WP_001295307.1.13624 WP_001295307.1.13626 WP_001295307.1.13644 WP_001295307.1.13656 WP_001295307.1.13662 WP_001295307.1.13664 WP_001295307.1.13672 WP_001295307.1.13740 WP_001295307.1.13778 WP_001295307.1.13791 WP_001295307.1.13824 WP_001295307.1.13881 WP_001295307.1.13891 WP_001295307.1.13924 WP_001295307.1.13934 WP_001295307.1.13936 WP_001295307.1.13939 WP_001295307.1.13944 WP_001295307.1.13949 WP_001295307.1.13974 WP_001295307.1.13981 WP_001295307.1.14023 WP_001295307.1.14030 WP_001295307.1.14042 WP_001295307.1.14058 WP_001295307.1.14062 WP_001295307.1.14070 WP_001295307.1.14094 WP_001295307.1.14110 WP_001295307.1.14127 WP_001295307.1.14144 WP_001295307.1.14154 WP_001295307.1.14164 WP_001295307.1.1419 WP_001295307.1.14199 WP_001295307.1.142 WP_001295307.1.14245 WP_001295307.1.14277 WP_001295307.1.14292 WP_001295307.1.14299 WP_001295307.1.14304 WP_001295307.1.14322 WP_001295307.1.14331 WP_001295307.1.14346 WP_001295307.1.14371 WP_001295307.1.1438 WP_001295307.1.14389 WP_001295307.1.14398 WP_001295307.1.14417 WP_001295307.1.14432 WP_001295307.1.14445 WP_001295307.1.14451 WP_001295307.1.14453 WP_001295307.1.14468 WP_001295307.1.14493 WP_001295307.1.14499 WP_001295307.1.14501 WP_001295307.1.14506 WP_001295307.1.14508 WP_001295307.1.14509 WP_001295307.1.14529 WP_001295307.1.14536 WP_001295307.1.14538 WP_001295307.1.14581 WP_001295307.1.14582 WP_001295307.1.14600 WP_001295307.1.14601 WP_001295307.1.14605 WP_001295307.1.14607 WP_001295307.1.1461 WP_001295307.1.14616 WP_001295307.1.14621 WP_001295307.1.14648 WP_001295307.1.14661 WP_001295307.1.14672 WP_001295307.1.14678 WP_001295307.1.14687 WP_001295307.1.14693 WP_001295307.1.1470 WP_001295307.1.14711 WP_001295307.1.14712 WP_001295307.1.14746 WP_001295307.1.14748 WP_001295307.1.14749 WP_001295307.1.14807 WP_001295307.1.14811 WP_001295307.1.14833 WP_001295307.1.1486 WP_001295307.1.14861 WP_001295307.1.14871 WP_001295307.1.14879 WP_001295307.1.14914 WP_001295307.1.14934 WP_001295307.1.14935 WP_001295307.1.14946 WP_001295307.1.14956 WP_001295307.1.14958 WP_001295307.1.14963 WP_001295307.1.14965 WP_001295307.1.14977 WP_001295307.1.14992 WP_001295307.1.14993 WP_001295307.1.15007 WP_001295307.1.15020 WP_001295307.1.15041 WP_001295307.1.1508 WP_001295307.1.15087 WP_001295307.1.15090 WP_001295307.1.1510 WP_001295307.1.15117 WP_001295307.1.1512 WP_001295307.1.15121 WP_001295307.1.15138 WP_001295307.1.15148 WP_001295307.1.15177 WP_001295307.1.15191 WP_001295307.1.15193 WP_001295307.1.15207 WP_001295307.1.15221 WP_001295307.1.1524 WP_001295307.1.15245 WP_001295307.1.15252 WP_001295307.1.15259 WP_001295307.1.15270 WP_001295307.1.15274 WP_001295307.1.15277 WP_001295307.1.15282 WP_001295307.1.15287 WP_001295307.1.15290 WP_001295307.1.153 WP_001295307.1.15300 WP_001295307.1.15304 WP_001295307.1.15332 WP_001295307.1.15335 WP_001295307.1.15347 WP_001295307.1.15356 WP_001295307.1.15377 WP_001295307.1.15416 WP_001295307.1.1543 WP_001295307.1.15444 WP_001295307.1.15453 WP_001295307.1.15464 WP_001295307.1.15469 WP_001295307.1.15496 WP_001295307.1.1550 WP_001295307.1.15503 WP_001295307.1.15521 WP_001295307.1.15527 WP_001295307.1.15528 WP_001295307.1.15538 WP_001295307.1.15565 WP_001295307.1.15583 WP_001295307.1.1559 WP_001295307.1.15593 WP_001295307.1.15600 WP_001295307.1.1561 WP_001295307.1.15620 WP_001295307.1.15624 WP_001295307.1.15626 WP_001295307.1.15645 WP_001295307.1.15654 WP_001295307.1.15702 WP_001295307.1.15707 WP_001295307.1.15731 WP_001295307.1.15740 WP_001295307.1.15747 WP_001295307.1.15752 WP_001295307.1.15762 WP_001295307.1.15767 WP_001295307.1.15771 WP_001295307.1.15782 WP_001295307.1.15791 WP_001295307.1.1580 WP_001295307.1.15809 WP_001295307.1.1582 WP_001295307.1.15855 WP_001295307.1.15857 WP_001295307.1.15863 WP_001295307.1.15869 WP_001295307.1.1588 WP_001295307.1.15894 WP_001295307.1.15906 WP_001295307.1.15916 WP_001295307.1.15945 WP_001295307.1.15949 WP_001295307.1.15951 WP_001295307.1.15983 WP_001295307.1.15984 WP_001295307.1.15990 WP_001295307.1.16010 WP_001295307.1.16014 WP_001295307.1.16015 WP_001295307.1.16034 WP_001295307.1.1604 WP_001295307.1.16067 WP_001295307.1.16075 WP_001295307.1.16087 WP_001295307.1.1609 WP_001295307.1.16102 WP_001295307.1.16111 WP_001295307.1.16117 WP_001295307.1.16131 WP_001295307.1.16133 WP_001295307.1.16154 WP_001295307.1.16175 WP_001295307.1.16179 WP_001295307.1.16183 WP_001295307.1.16188 WP_001295307.1.16194 WP_001295307.1.1621 WP_001295307.1.1622 WP_001295307.1.16222 WP_001295307.1.16270 WP_001295307.1.16272 WP_001295307.1.16294 WP_001295307.1.163 WP_001295307.1.16303 WP_001295307.1.1634 WP_001295307.1.16387 WP_001295307.1.16388 WP_001295307.1.16396 WP_001295307.1.1640 WP_001295307.1.16435 WP_001295307.1.16463 WP_001295307.1.16481 WP_001295307.1.16482 WP_001295307.1.16500 WP_001295307.1.16517 WP_001295307.1.16532 WP_001295307.1.16539 WP_001295307.1.16541 WP_001295307.1.1655 WP_001295307.1.16577 WP_001295307.1.16604 WP_001295307.1.16608 WP_001295307.1.16612 WP_001295307.1.16640 WP_001295307.1.16648 WP_001295307.1.16667 WP_001295307.1.16669 WP_001295307.1.16682 WP_001295307.1.16685 WP_001295307.1.16700 WP_001295307.1.16705 WP_001295307.1.16715 WP_001295307.1.16721 WP_001295307.1.16745 WP_001295307.1.16752 WP_001295307.1.16766 WP_001295307.1.16798 WP_001295307.1.16799 WP_001295307.1.16805 WP_001295307.1.16807 WP_001295307.1.16818 WP_001295307.1.16843 WP_001295307.1.16845 WP_001295307.1.16861 WP_001295307.1.16894 WP_001295307.1.16927 WP_001295307.1.16970 WP_001295307.1.16979 WP_001295307.1.16992 WP_001295307.1.17014 WP_001295307.1.17017 WP_001295307.1.17028 WP_001295307.1.17042 WP_001295307.1.17061 WP_001295307.1.17085 WP_001295307.1.17087 WP_001295307.1.17089 WP_001295307.1.1710 WP_001295307.1.17101 WP_001295307.1.17102 WP_001295307.1.17109 WP_001295307.1.17111 WP_001295307.1.17114 WP_001295307.1.17119 WP_001295307.1.17123 WP_001295307.1.17150 WP_001295307.1.17153 WP_001295307.1.17170 WP_001295307.1.17172 WP_001295307.1.17182 WP_001295307.1.17186 WP_001295307.1.17187 WP_001295307.1.17205 WP_001295307.1.17206 WP_001295307.1.17216 WP_001295307.1.17230 WP_001295307.1.17241 WP_001295307.1.17242 WP_001295307.1.1726 WP_001295307.1.17267 WP_001295307.1.17282 WP_001295307.1.17290 WP_001295307.1.17297 WP_001295307.1.17300 WP_001295307.1.17301 WP_001295307.1.1731 WP_001295307.1.17325 WP_001295307.1.17356 WP_001295307.1.17360 WP_001295307.1.17373 WP_001295307.1.17386 WP_001295307.1.17387 WP_001295307.1.17389 WP_001295307.1.17392 WP_001295307.1.17403 WP_001295307.1.17410 WP_001295307.1.17415 WP_001295307.1.17417 WP_001295307.1.17432 WP_001295307.1.17441 WP_001295307.1.17461 WP_001295307.1.17464 WP_001295307.1.17496 WP_001295307.1.17515 WP_001295307.1.17534 WP_001295307.1.1755 WP_001295307.1.17550 WP_001295307.1.17568 WP_001295307.1.17570 WP_001295307.1.17577 WP_001295307.1.17584 WP_001295307.1.17595 WP_001295307.1.17623 WP_001295307.1.1763 WP_001295307.1.17637 WP_001295307.1.1766 WP_001295307.1.17680 WP_001295307.1.1769 WP_001295307.1.17701 WP_001295307.1.17711 WP_001295307.1.1772 WP_001295307.1.17757 WP_001295307.1.17765 WP_001295307.1.17766 WP_001295307.1.17769 WP_001295307.1.1778 WP_001295307.1.17802 WP_001295307.1.17829 WP_001295307.1.17831 WP_001295307.1.17836 WP_001295307.1.17849 WP_001295307.1.17889 WP_001295307.1.17904 WP_001295307.1.17920 WP_001295307.1.17925 WP_001295307.1.17937 WP_001295307.1.17961 WP_001295307.1.17963 WP_001295307.1.17984 WP_001295307.1.18000 WP_001295307.1.18006 WP_001295307.1.1802 WP_001295307.1.18024 WP_001295307.1.18050 WP_001295307.1.18064 WP_001295307.1.18094 WP_001295307.1.18112 WP_001295307.1.18118 WP_001295307.1.18121 WP_001295307.1.18133 WP_001295307.1.18134 WP_001295307.1.18136 WP_001295307.1.18164 WP_001295307.1.18175 WP_001295307.1.1821 WP_001295307.1.18226 WP_001295307.1.18229 WP_001295307.1.18275 WP_001295307.1.18311 WP_001295307.1.18316 WP_001295307.1.18326 WP_001295307.1.18329 WP_001295307.1.18337 WP_001295307.1.18338 WP_001295307.1.1834 WP_001295307.1.18340 WP_001295307.1.18348 WP_001295307.1.18354 WP_001295307.1.18381 WP_001295307.1.18383 WP_001295307.1.18394 WP_001295307.1.18402 WP_001295307.1.18410 WP_001295307.1.18436 WP_001295307.1.18438 WP_001295307.1.18458 WP_001295307.1.18461 WP_001295307.1.18472 WP_001295307.1.18482 WP_001295307.1.18511 WP_001295307.1.18519 WP_001295307.1.18530 WP_001295307.1.18550 WP_001295307.1.18556 WP_001295307.1.18581 WP_001295307.1.18583 WP_001295307.1.1861 WP_001295307.1.18617 WP_001295307.1.1862 WP_001295307.1.18628 WP_001295307.1.18649 WP_001295307.1.18650 WP_001295307.1.18651 WP_001295307.1.18655 WP_001295307.1.1866 WP_001295307.1.18666 WP_001295307.1.1867 WP_001295307.1.18675 WP_001295307.1.18725 WP_001295307.1.18726 WP_001295307.1.1873 WP_001295307.1.18734 WP_001295307.1.18794 WP_001295307.1.188 WP_001295307.1.18801 WP_001295307.1.18802 WP_001295307.1.18806 WP_001295307.1.1881 WP_001295307.1.18828 WP_001295307.1.18837 WP_001295307.1.18843 WP_001295307.1.18858 WP_001295307.1.18861 WP_001295307.1.18874 WP_001295307.1.18876 WP_001295307.1.18899 WP_001295307.1.18908 WP_001295307.1.18923 WP_001295307.1.18929 WP_001295307.1.18934 WP_001295307.1.18936 WP_001295307.1.1896 WP_001295307.1.18962 WP_001295307.1.18966 WP_001295307.1.18983 WP_001295307.1.18995 WP_001295307.1.19024 WP_001295307.1.1903 WP_001295307.1.19036 WP_001295307.1.19039 WP_001295307.1.1906 WP_001295307.1.19075 WP_001295307.1.1909 WP_001295307.1.19090 WP_001295307.1.191 WP_001295307.1.19100 WP_001295307.1.19113 WP_001295307.1.19114 WP_001295307.1.19122 WP_001295307.1.19135 WP_001295307.1.19140 WP_001295307.1.19147 WP_001295307.1.19148 WP_001295307.1.1915 WP_001295307.1.19150 WP_001295307.1.19153 WP_001295307.1.19171 WP_001295307.1.19194 WP_001295307.1.19205 WP_001295307.1.19206 WP_001295307.1.19245 WP_001295307.1.1925 WP_001295307.1.19276 WP_001295307.1.19277 WP_001295307.1.19297 WP_001295307.1.193 WP_001295307.1.19312 WP_001295307.1.19313 WP_001295307.1.19314 WP_001295307.1.19315 WP_001295307.1.19332 WP_001295307.1.19338 WP_001295307.1.19347 WP_001295307.1.19350 WP_001295307.1.19361 WP_001295307.1.19374 WP_001295307.1.19379 WP_001295307.1.19389 WP_001295307.1.19397 WP_001295307.1.19424 WP_001295307.1.19441 WP_001295307.1.19448 WP_001295307.1.19453 WP_001295307.1.19465 WP_001295307.1.19478 WP_001295307.1.19487 WP_001295307.1.19494 WP_001295307.1.1952 WP_001295307.1.19534 WP_001295307.1.19544 WP_001295307.1.19547 WP_001295307.1.19557 WP_001295307.1.19581 WP_001295307.1.19583 WP_001295307.1.19593 WP_001295307.1.1960 WP_001295307.1.19602 WP_001295307.1.1963 WP_001295307.1.19644 WP_001295307.1.19649 WP_001295307.1.19654 WP_001295307.1.19655 WP_001295307.1.19661 WP_001295307.1.19684 WP_001295307.1.19691 WP_001295307.1.19758 WP_001295307.1.19760 WP_001295307.1.19761 WP_001295307.1.19778 WP_001295307.1.19795 WP_001295307.1.1982 WP_001295307.1.19830 WP_001295307.1.19838 WP_001295307.1.19840 WP_001295307.1.19845 WP_001295307.1.19847 WP_001295307.1.19861 WP_001295307.1.1987 WP_001295307.1.19873 WP_001295307.1.19878 WP_001295307.1.19889 WP_001295307.1.19940 WP_001295307.1.19945 WP_001295307.1.19957 WP_001295307.1.19972 WP_001295307.1.19994 WP_001295307.1.2005 WP_001295307.1.20096 WP_001295307.1.20114 WP_001295307.1.20115 WP_001295307.1.20129 WP_001295307.1.20133 WP_001295307.1.20136 WP_001295307.1.20151 WP_001295307.1.20157 WP_001295307.1.20159 WP_001295307.1.20166 WP_001295307.1.20170 WP_001295307.1.20178 WP_001295307.1.20183 WP_001295307.1.20192 WP_001295307.1.20215 WP_001295307.1.2022 WP_001295307.1.20224 WP_001295307.1.20230 WP_001295307.1.20238 WP_001295307.1.20251 WP_001295307.1.20264 WP_001295307.1.2027 WP_001295307.1.20277 WP_001295307.1.20289 WP_001295307.1.20290 WP_001295307.1.20308 WP_001295307.1.20318 WP_001295307.1.20325 WP_001295307.1.20331 WP_001295307.1.20334 WP_001295307.1.20370 WP_001295307.1.20388 WP_001295307.1.20445 WP_001295307.1.20449 WP_001295307.1.20452 WP_001295307.1.20480 WP_001295307.1.20483 WP_001295307.1.20484 WP_001295307.1.20493 WP_001295307.1.20506 WP_001295307.1.20515 WP_001295307.1.20519 WP_001295307.1.20536 WP_001295307.1.20546 WP_001295307.1.20549 WP_001295307.1.20565 WP_001295307.1.20575 WP_001295307.1.20594 WP_001295307.1.20596 WP_001295307.1.20609 WP_001295307.1.2063 WP_001295307.1.20636 WP_001295307.1.20638 WP_001295307.1.20640 WP_001295307.1.20662 WP_001295307.1.20668 WP_001295307.1.20691 WP_001295307.1.20709 WP_001295307.1.20724 WP_001295307.1.20730 WP_001295307.1.20737 WP_001295307.1.20741 WP_001295307.1.20745 WP_001295307.1.2075 WP_001295307.1.20761 WP_001295307.1.20765 WP_001295307.1.20784 WP_001295307.1.20785 WP_001295307.1.20803 WP_001295307.1.20813 WP_001295307.1.20818 WP_001295307.1.20824 WP_001295307.1.20831 WP_001295307.1.20841 WP_001295307.1.20848 WP_001295307.1.20863 WP_001295307.1.20893 WP_001295307.1.2092 WP_001295307.1.2093 WP_001295307.1.20933 WP_001295307.1.2094 WP_001295307.1.20941 WP_001295307.1.20943 WP_001295307.1.20950 WP_001295307.1.20958 WP_001295307.1.20962 WP_001295307.1.20982 WP_001295307.1.20989 WP_001295307.1.2100 WP_001295307.1.21017 WP_001295307.1.21020 WP_001295307.1.21022 WP_001295307.1.21033 WP_001295307.1.21041 WP_001295307.1.21057 WP_001295307.1.21059 WP_001295307.1.21104 WP_001295307.1.21122 WP_001295307.1.21129 WP_001295307.1.2113 WP_001295307.1.21131 WP_001295307.1.21137 WP_001295307.1.21152 WP_001295307.1.21171 WP_001295307.1.21197 WP_001295307.1.21236 WP_001295307.1.21251 WP_001295307.1.21255 WP_001295307.1.21266 WP_001295307.1.21277 WP_001295307.1.21305 WP_001295307.1.21320 WP_001295307.1.21336 WP_001295307.1.21378 WP_001295307.1.2142 WP_001295307.1.21441 WP_001295307.1.21450 WP_001295307.1.21455 WP_001295307.1.21470 WP_001295307.1.21519 WP_001295307.1.21526 WP_001295307.1.21537 WP_001295307.1.2156 WP_001295307.1.21573 WP_001295307.1.21578 WP_001295307.1.21596 WP_001295307.1.21614 WP_001295307.1.21628 WP_001295307.1.21634 WP_001295307.1.21637 WP_001295307.1.2164 WP_001295307.1.21652 WP_001295307.1.21656 WP_001295307.1.21661 WP_001295307.1.21666 WP_001295307.1.21667 WP_001295307.1.21668 WP_001295307.1.21673 WP_001295307.1.21696 WP_001295307.1.21714 WP_001295307.1.21727 WP_001295307.1.21729 WP_001295307.1.21732 WP_001295307.1.21733 WP_001295307.1.21756 WP_001295307.1.21758 WP_001295307.1.21762 WP_001295307.1.21771 WP_001295307.1.21773 WP_001295307.1.21811 WP_001295307.1.21812 WP_001295307.1.21823 WP_001295307.1.21887 WP_001295307.1.21895 WP_001295307.1.21899 WP_001295307.1.21915 WP_001295307.1.21945 WP_001295307.1.21948 WP_001295307.1.2198 WP_001295307.1.21992 WP_001295307.1.22021 WP_001295307.1.22042 WP_001295307.1.22060 WP_001295307.1.22088 WP_001295307.1.22098 WP_001295307.1.22113 WP_001295307.1.22138 WP_001295307.1.22161 WP_001295307.1.2218 WP_001295307.1.22182 WP_001295307.1.22189 WP_001295307.1.22195 WP_001295307.1.22203 WP_001295307.1.22204 WP_001295307.1.22251 WP_001295307.1.22268 WP_001295307.1.22269 WP_001295307.1.22272 WP_001295307.1.22280 WP_001295307.1.22291 WP_001295307.1.22293 WP_001295307.1.22295 WP_001295307.1.22304 WP_001295307.1.22314 WP_001295307.1.2232 WP_001295307.1.22325 WP_001295307.1.22328 WP_001295307.1.22350 WP_001295307.1.22359 WP_001295307.1.22363 WP_001295307.1.22409 WP_001295307.1.2242 WP_001295307.1.22431 WP_001295307.1.2245 WP_001295307.1.22450 WP_001295307.1.22464 WP_001295307.1.22470 WP_001295307.1.22494 WP_001295307.1.22501 WP_001295307.1.22508 WP_001295307.1.22522 WP_001295307.1.22543 WP_001295307.1.22544 WP_001295307.1.22549 WP_001295307.1.22571 WP_001295307.1.22572 WP_001295307.1.22574 WP_001295307.1.22576 WP_001295307.1.22579 WP_001295307.1.22594 WP_001295307.1.22599 WP_001295307.1.22602 WP_001295307.1.22631 WP_001295307.1.22632 WP_001295307.1.22641 WP_001295307.1.22649 WP_001295307.1.22662 WP_001295307.1.22667 WP_001295307.1.22685 WP_001295307.1.22690 WP_001295307.1.22691 WP_001295307.1.22743 WP_001295307.1.22756 WP_001295307.1.22757 WP_001295307.1.22759 WP_001295307.1.22765 WP_001295307.1.22771 WP_001295307.1.22777 WP_001295307.1.22783 WP_001295307.1.22809 WP_001295307.1.22814 WP_001295307.1.22824 WP_001295307.1.22827 WP_001295307.1.22830 WP_001295307.1.22846 WP_001295307.1.22868 WP_001295307.1.22875 WP_001295307.1.22878 WP_001295307.1.22885 WP_001295307.1.22896 WP_001295307.1.22908 WP_001295307.1.22917 WP_001295307.1.22961 WP_001295307.1.22988 WP_001295307.1.22990 WP_001295307.1.22993 WP_001295307.1.2300 WP_001295307.1.23005 WP_001295307.1.23026 WP_001295307.1.23035 WP_001295307.1.23044 WP_001295307.1.23045 WP_001295307.1.23057 WP_001295307.1.23062 WP_001295307.1.23073 WP_001295307.1.23078 WP_001295307.1.23081 WP_001295307.1.23090 WP_001295307.1.23092 WP_001295307.1.23105 WP_001295307.1.23109 WP_001295307.1.23115 WP_001295307.1.23120 WP_001295307.1.23135 WP_001295307.1.2322 WP_001295307.1.23230 WP_001295307.1.23241 WP_001295307.1.23257 WP_001295307.1.23270 WP_001295307.1.23282 WP_001295307.1.23285 WP_001295307.1.23290 WP_001295307.1.23293 WP_001295307.1.23299 WP_001295307.1.23323 WP_001295307.1.23330 WP_001295307.1.23351 WP_001295307.1.23352 WP_001295307.1.23355 WP_001295307.1.23376 WP_001295307.1.23378 WP_001295307.1.23383 WP_001295307.1.23386 WP_001295307.1.23388 WP_001295307.1.23393 WP_001295307.1.23435 WP_001295307.1.23443 WP_001295307.1.23456 WP_001295307.1.23463 WP_001295307.1.23467 WP_001295307.1.23486 WP_001295307.1.23487 WP_001295307.1.23511 WP_001295307.1.23520 WP_001295307.1.23522 WP_001295307.1.2353 WP_001295307.1.23549 WP_001295307.1.23554 WP_001295307.1.23561 WP_001295307.1.23563 WP_001295307.1.23575 WP_001295307.1.23584 WP_001295307.1.23593 WP_001295307.1.23622 WP_001295307.1.23625 WP_001295307.1.23640 WP_001295307.1.23660 WP_001295307.1.23676 WP_001295307.1.23686 WP_001295307.1.23693 WP_001295307.1.23700 WP_001295307.1.23711 WP_001295307.1.23724 WP_001295307.1.23729 WP_001295307.1.23741 WP_001295307.1.23752 WP_001295307.1.23754 WP_001295307.1.23765 WP_001295307.1.23790 WP_001295307.1.23795 WP_001295307.1.23804 WP_001295307.1.23806 WP_001295307.1.23812 WP_001295307.1.23838 WP_001295307.1.23840 WP_001295307.1.23855 WP_001295307.1.23869 WP_001295307.1.23881 WP_001295307.1.23886 WP_001295307.1.23890 WP_001295307.1.23895 WP_001295307.1.23898 WP_001295307.1.23899 WP_001295307.1.23914 WP_001295307.1.23915 WP_001295307.1.23931 WP_001295307.1.23945 WP_001295307.1.2395 WP_001295307.1.23950 WP_001295307.1.23953 WP_001295307.1.23962 WP_001295307.1.23971 WP_001295307.1.23973 WP_001295307.1.23984 WP_001295307.1.23985 WP_001295307.1.24 WP_001295307.1.24004 WP_001295307.1.24024 WP_001295307.1.24038 WP_001295307.1.24045 WP_001295307.1.24051 WP_001295307.1.24058 WP_001295307.1.24068 WP_001295307.1.24070 WP_001295307.1.24088 WP_001295307.1.24089 WP_001295307.1.24120 WP_001295307.1.24124 WP_001295307.1.24127 WP_001295307.1.2413 WP_001295307.1.24136 WP_001295307.1.24169 WP_001295307.1.24177 WP_001295307.1.2418 WP_001295307.1.24194 WP_001295307.1.24278 WP_001295307.1.2428 WP_001295307.1.24283 WP_001295307.1.24290 WP_001295307.1.2430 WP_001295307.1.24316 WP_001295307.1.2433 WP_001295307.1.24341 WP_001295307.1.24362 WP_001295307.1.2437 WP_001295307.1.24374 WP_001295307.1.24381 WP_001295307.1.24383 WP_001295307.1.24458 WP_001295307.1.24460 WP_001295307.1.24473 WP_001295307.1.24483 WP_001295307.1.2449 WP_001295307.1.24499 WP_001295307.1.24523 WP_001295307.1.24524 WP_001295307.1.24533 WP_001295307.1.24536 WP_001295307.1.24547 WP_001295307.1.2456 WP_001295307.1.24560 WP_001295307.1.24570 WP_001295307.1.24575 WP_001295307.1.24577 WP_001295307.1.24583 WP_001295307.1.24592 WP_001295307.1.24616 WP_001295307.1.24634 WP_001295307.1.24641 WP_001295307.1.24642 WP_001295307.1.24646 WP_001295307.1.24650 WP_001295307.1.2469 WP_001295307.1.24693 WP_001295307.1.24695 WP_001295307.1.24703 WP_001295307.1.24752 WP_001295307.1.24753 WP_001295307.1.24758 WP_001295307.1.24763 WP_001295307.1.24783 WP_001295307.1.24791 WP_001295307.1.24797 WP_001295307.1.24799 WP_001295307.1.24808 WP_001295307.1.24849 WP_001295307.1.24854 WP_001295307.1.24876 WP_001295307.1.24899 WP_001295307.1.24906 WP_001295307.1.24909 WP_001295307.1.24926 WP_001295307.1.24929 WP_001295307.1.24939 WP_001295307.1.24946 WP_001295307.1.24960 WP_001295307.1.24968 WP_001295307.1.24979 WP_001295307.1.24981 WP_001295307.1.24982 WP_001295307.1.24984 WP_001295307.1.25019 WP_001295307.1.2502 WP_001295307.1.25021 WP_001295307.1.25038 WP_001295307.1.25039 WP_001295307.1.2504 WP_001295307.1.25042 WP_001295307.1.25050 WP_001295307.1.25060 WP_001295307.1.25076 WP_001295307.1.25079 WP_001295307.1.25082 WP_001295307.1.25085 WP_001295307.1.25086 WP_001295307.1.25087 WP_001295307.1.25088 WP_001295307.1.2512 WP_001295307.1.25126 WP_001295307.1.25141 WP_001295307.1.25174 WP_001295307.1.25183 WP_001295307.1.25193 WP_001295307.1.25201 WP_001295307.1.25203 WP_001295307.1.25204 WP_001295307.1.25248 WP_001295307.1.25270 WP_001295307.1.25272 WP_001295307.1.25289 WP_001295307.1.25305 WP_001295307.1.2531 WP_001295307.1.25312 WP_001295307.1.25324 WP_001295307.1.25346 WP_001295307.1.2537 WP_001295307.1.25372 WP_001295307.1.25378 WP_001295307.1.25380 WP_001295307.1.254 WP_001295307.1.2540 WP_001295307.1.25403 WP_001295307.1.25414 WP_001295307.1.25420 WP_001295307.1.2543 WP_001295307.1.25446 WP_001295307.1.25480 WP_001295307.1.255 WP_001295307.1.25517 WP_001295307.1.25525 WP_001295307.1.25526 WP_001295307.1.25548 WP_001295307.1.25577 WP_001295307.1.2558 WP_001295307.1.25592 WP_001295307.1.25598 WP_001295307.1.25602 WP_001295307.1.25613 WP_001295307.1.25631 WP_001295307.1.25643 WP_001295307.1.25652 WP_001295307.1.2567 WP_001295307.1.25680 WP_001295307.1.25681 WP_001295307.1.25701 WP_001295307.1.25712 WP_001295307.1.25713 WP_001295307.1.25717 WP_001295307.1.25718 WP_001295307.1.25726 WP_001295307.1.25750 WP_001295307.1.25753 WP_001295307.1.25755 WP_001295307.1.25794 WP_001295307.1.25799 WP_001295307.1.25819 WP_001295307.1.25831 WP_001295307.1.25832 WP_001295307.1.25843 WP_001295307.1.25855 WP_001295307.1.25869 WP_001295307.1.25873 WP_001295307.1.2588 WP_001295307.1.25886 WP_001295307.1.2589 WP_001295307.1.25890 WP_001295307.1.25895 WP_001295307.1.25915 WP_001295307.1.25945 WP_001295307.1.2597 WP_001295307.1.25996 WP_001295307.1.26005 WP_001295307.1.26040 WP_001295307.1.26048 WP_001295307.1.26055 WP_001295307.1.2606 WP_001295307.1.26061 WP_001295307.1.26066 WP_001295307.1.26076 WP_001295307.1.26092 WP_001295307.1.26100 WP_001295307.1.26105 WP_001295307.1.2612 WP_001295307.1.26121 WP_001295307.1.26130 WP_001295307.1.26131 WP_001295307.1.26134 WP_001295307.1.26135 WP_001295307.1.26150 WP_001295307.1.26161 WP_001295307.1.26175 WP_001295307.1.26186 WP_001295307.1.26189 WP_001295307.1.26191 WP_001295307.1.26196 WP_001295307.1.26246 WP_001295307.1.26259 WP_001295307.1.26262 WP_001295307.1.26264 WP_001295307.1.26270 WP_001295307.1.26284 WP_001295307.1.26304 WP_001295307.1.26325 WP_001295307.1.26331 WP_001295307.1.2637 WP_001295307.1.26379 WP_001295307.1.26391 WP_001295307.1.26398 WP_001295307.1.26401 WP_001295307.1.26403 WP_001295307.1.26419 WP_001295307.1.2642 WP_001295307.1.26438 WP_001295307.1.26467 WP_001295307.1.26474 WP_001295307.1.26479 WP_001295307.1.26480 WP_001295307.1.26517 WP_001295307.1.26525 WP_001295307.1.26569 WP_001295307.1.26570 WP_001295307.1.26574 WP_001295307.1.26575 WP_001295307.1.26579 WP_001295307.1.26588 WP_001295307.1.26590 WP_001295307.1.26598 WP_001295307.1.26609 WP_001295307.1.26613 WP_001295307.1.26627 WP_001295307.1.2665 WP_001295307.1.26658 WP_001295307.1.26659 WP_001295307.1.26660 WP_001295307.1.26688 WP_001295307.1.26716 WP_001295307.1.26720 WP_001295307.1.26761 WP_001295307.1.26782 WP_001295307.1.26837 WP_001295307.1.26839 WP_001295307.1.26861 WP_001295307.1.26878 WP_001295307.1.2688 WP_001295307.1.26912 WP_001295307.1.26932 WP_001295307.1.2694 WP_001295307.1.26941 WP_001295307.1.2695 WP_001295307.1.26950 WP_001295307.1.26975 WP_001295307.1.26987 WP_001295307.1.26995 WP_001295307.1.26998 WP_001295307.1.2700 WP_001295307.1.27019 WP_001295307.1.27043 WP_001295307.1.27057 WP_001295307.1.27060 WP_001295307.1.27091 WP_001295307.1.27098 WP_001295307.1.27101 WP_001295307.1.27105 WP_001295307.1.2712 WP_001295307.1.27134 WP_001295307.1.27141 WP_001295307.1.27148 WP_001295307.1.27175 WP_001295307.1.27188 WP_001295307.1.27214 WP_001295307.1.27234 WP_001295307.1.27260 WP_001295307.1.27280 WP_001295307.1.27283 WP_001295307.1.27292 WP_001295307.1.2731 WP_001295307.1.27310 WP_001295307.1.27313 WP_001295307.1.27330 WP_001295307.1.27338 WP_001295307.1.27367 WP_001295307.1.27373 WP_001295307.1.27396 WP_001295307.1.27401 WP_001295307.1.27424 WP_001295307.1.27445 WP_001295307.1.2745 WP_001295307.1.27451 WP_001295307.1.27472 WP_001295307.1.27504 WP_001295307.1.27518 WP_001295307.1.27520 WP_001295307.1.27524 WP_001295307.1.2755 WP_001295307.1.27560 WP_001295307.1.27580 WP_001295307.1.27585 WP_001295307.1.27611 WP_001295307.1.27618 WP_001295307.1.27683 WP_001295307.1.27691 WP_001295307.1.27698 WP_001295307.1.27723 WP_001295307.1.27741 WP_001295307.1.27742 WP_001295307.1.27749 WP_001295307.1.27758 WP_001295307.1.27774 WP_001295307.1.27786 WP_001295307.1.2779 WP_001295307.1.27797 WP_001295307.1.2782 WP_001295307.1.27846 WP_001295307.1.27856 WP_001295307.1.27861 WP_001295307.1.27871 WP_001295307.1.27876 WP_001295307.1.27879 WP_001295307.1.27897 WP_001295307.1.27913 WP_001295307.1.27923 WP_001295307.1.27932 WP_001295307.1.2794 WP_001295307.1.27957 WP_001295307.1.27998 WP_001295307.1.28008 WP_001295307.1.28026 WP_001295307.1.28027 WP_001295307.1.28051 WP_001295307.1.28102 WP_001295307.1.28128 WP_001295307.1.28143 WP_001295307.1.28145 WP_001295307.1.28156 WP_001295307.1.28167 WP_001295307.1.28168 WP_001295307.1.28184 WP_001295307.1.28199 WP_001295307.1.28250 WP_001295307.1.2826 WP_001295307.1.28268 WP_001295307.1.28271 WP_001295307.1.28305 WP_001295307.1.28314 WP_001295307.1.28318 WP_001295307.1.28322 WP_001295307.1.28345 WP_001295307.1.28349 WP_001295307.1.28371 WP_001295307.1.2838 WP_001295307.1.28401 WP_001295307.1.28414 WP_001295307.1.28433 WP_001295307.1.28440 WP_001295307.1.28461 WP_001295307.1.28476 WP_001295307.1.28480 WP_001295307.1.28491 WP_001295307.1.28496 WP_001295307.1.285 WP_001295307.1.28500 WP_001295307.1.28509 WP_001295307.1.28540 WP_001295307.1.28544 WP_001295307.1.28551 WP_001295307.1.28554 WP_001295307.1.28568 WP_001295307.1.28639 WP_001295307.1.2866 WP_001295307.1.28662 WP_001295307.1.28683 WP_001295307.1.28697 WP_001295307.1.28711 WP_001295307.1.28723 WP_001295307.1.28732 WP_001295307.1.28734 WP_001295307.1.28736 WP_001295307.1.28742 WP_001295307.1.28760 WP_001295307.1.28762 WP_001295307.1.28769 WP_001295307.1.28791 WP_001295307.1.28809 WP_001295307.1.2881 WP_001295307.1.28829 WP_001295307.1.28835 WP_001295307.1.28842 WP_001295307.1.28879 WP_001295307.1.28919 WP_001295307.1.28924 WP_001295307.1.28950 WP_001295307.1.28953 WP_001295307.1.28982 WP_001295307.1.28994 WP_001295307.1.290 WP_001295307.1.29001 WP_001295307.1.29013 WP_001295307.1.29016 WP_001295307.1.29026 WP_001295307.1.29049 WP_001295307.1.29061 WP_001295307.1.29079 WP_001295307.1.29082 WP_001295307.1.291 WP_001295307.1.29100 WP_001295307.1.29118 WP_001295307.1.29125 WP_001295307.1.29126 WP_001295307.1.29128 WP_001295307.1.29146 WP_001295307.1.29150 WP_001295307.1.29164 WP_001295307.1.29176 WP_001295307.1.29194 WP_001295307.1.29197 WP_001295307.1.29202 WP_001295307.1.29206 WP_001295307.1.29221 WP_001295307.1.29239 WP_001295307.1.29252 WP_001295307.1.29258 WP_001295307.1.2926 WP_001295307.1.2931 WP_001295307.1.29341 WP_001295307.1.29377 WP_001295307.1.29394 WP_001295307.1.29404 WP_001295307.1.2942 WP_001295307.1.29429 WP_001295307.1.29443 WP_001295307.1.2945 WP_001295307.1.29486 WP_001295307.1.29495 WP_001295307.1.29497 WP_001295307.1.29503 WP_001295307.1.29504 WP_001295307.1.29513 WP_001295307.1.2952 WP_001295307.1.29523 WP_001295307.1.2954 WP_001295307.1.29556 WP_001295307.1.29590 WP_001295307.1.29597 WP_001295307.1.29603 WP_001295307.1.29618 WP_001295307.1.2963 WP_001295307.1.29643 WP_001295307.1.29647 WP_001295307.1.29662 WP_001295307.1.29669 WP_001295307.1.29683 WP_001295307.1.29689 WP_001295307.1.29699 WP_001295307.1.29715 WP_001295307.1.29724 WP_001295307.1.29740 WP_001295307.1.29746 WP_001295307.1.29752 WP_001295307.1.2978 WP_001295307.1.29798 WP_001295307.1.29812 WP_001295307.1.29815 WP_001295307.1.29818 WP_001295307.1.29819 WP_001295307.1.29820 WP_001295307.1.29821 WP_001295307.1.29840 WP_001295307.1.29855 WP_001295307.1.2986 WP_001295307.1.29874 WP_001295307.1.29876 WP_001295307.1.29884 WP_001295307.1.29933 WP_001295307.1.2995 WP_001295307.1.29967 WP_001295307.1.29976 WP_001295307.1.29979 WP_001295307.1.29988 WP_001295307.1.29992 WP_001295307.1.30 WP_001295307.1.30004 WP_001295307.1.30016 WP_001295307.1.30019 WP_001295307.1.30035 WP_001295307.1.30052 WP_001295307.1.30063 WP_001295307.1.30064 WP_001295307.1.30098 WP_001295307.1.30105 WP_001295307.1.30141 WP_001295307.1.3018 WP_001295307.1.30221 WP_001295307.1.30231 WP_001295307.1.30232 WP_001295307.1.30239 WP_001295307.1.30247 WP_001295307.1.30253 WP_001295307.1.30269 WP_001295307.1.30298 WP_001295307.1.30347 WP_001295307.1.30391 WP_001295307.1.30397 WP_001295307.1.30399 WP_001295307.1.30400 WP_001295307.1.30401 WP_001295307.1.30428 WP_001295307.1.30447 WP_001295307.1.3045 WP_001295307.1.30452 WP_001295307.1.30472 WP_001295307.1.30476 WP_001295307.1.30479 WP_001295307.1.30497 WP_001295307.1.30524 WP_001295307.1.30536 WP_001295307.1.30546 WP_001295307.1.3055 WP_001295307.1.30550 WP_001295307.1.30554 WP_001295307.1.30570 WP_001295307.1.30580 WP_001295307.1.306 WP_001295307.1.3063 WP_001295307.1.30630 WP_001295307.1.30637 WP_001295307.1.30639 WP_001295307.1.30640 WP_001295307.1.30658 WP_001295307.1.30665 WP_001295307.1.30691 WP_001295307.1.30700 WP_001295307.1.30733 WP_001295307.1.30742 WP_001295307.1.30749 WP_001295307.1.30762 WP_001295307.1.30783 WP_001295307.1.30808 WP_001295307.1.3083 WP_001295307.1.30843 WP_001295307.1.30853 WP_001295307.1.30866 WP_001295307.1.30867 WP_001295307.1.30879 WP_001295307.1.30887 WP_001295307.1.30896 WP_001295307.1.309 WP_001295307.1.30905 WP_001295307.1.30906 WP_001295307.1.30918 WP_001295307.1.30960 WP_001295307.1.30987 WP_001295307.1.30993 WP_001295307.1.30999 WP_001295307.1.31000 WP_001295307.1.31009 WP_001295307.1.31017 WP_001295307.1.31026 WP_001295307.1.31029 WP_001295307.1.31055 WP_001295307.1.31083 WP_001295307.1.31089 WP_001295307.1.31119 WP_001295307.1.31129 WP_001295307.1.31142 WP_001295307.1.31149 WP_001295307.1.31188 WP_001295307.1.312 WP_001295307.1.31211 WP_001295307.1.31252 WP_001295307.1.31295 WP_001295307.1.31319 WP_001295307.1.31340 WP_001295307.1.31347 WP_001295307.1.31353 WP_001295307.1.31357 WP_001295307.1.31379 WP_001295307.1.3140 WP_001295307.1.31401 WP_001295307.1.31407 WP_001295307.1.31419 WP_001295307.1.31421 WP_001295307.1.31422 WP_001295307.1.31429 WP_001295307.1.31431 WP_001295307.1.31433 WP_001295307.1.31434 WP_001295307.1.3147 WP_001295307.1.31482 WP_001295307.1.31506 WP_001295307.1.31511 WP_001295307.1.31518 WP_001295307.1.31521 WP_001295307.1.31542 WP_001295307.1.31557 WP_001295307.1.31559 WP_001295307.1.31575 WP_001295307.1.31596 WP_001295307.1.31614 WP_001295307.1.31618 WP_001295307.1.31625 WP_001295307.1.31639 WP_001295307.1.31657 WP_001295307.1.31675 WP_001295307.1.31679 WP_001295307.1.31681 WP_001295307.1.3169 WP_001295307.1.31696 WP_001295307.1.31709 WP_001295307.1.31715 WP_001295307.1.31736 WP_001295307.1.31740 WP_001295307.1.3176 WP_001295307.1.31801 WP_001295307.1.31803 WP_001295307.1.31809 WP_001295307.1.3181 WP_001295307.1.31823 WP_001295307.1.31825 WP_001295307.1.31833 WP_001295307.1.31835 WP_001295307.1.31839 WP_001295307.1.31860 WP_001295307.1.31863 WP_001295307.1.31866 WP_001295307.1.31898 WP_001295307.1.31899 WP_001295307.1.31903 WP_001295307.1.31924 WP_001295307.1.31928 WP_001295307.1.3193 WP_001295307.1.31937 WP_001295307.1.31978 WP_001295307.1.3201 WP_001295307.1.32021 WP_001295307.1.32024 WP_001295307.1.3203 WP_001295307.1.32030 WP_001295307.1.32037 WP_001295307.1.32049 WP_001295307.1.32063 WP_001295307.1.32089 WP_001295307.1.32091 WP_001295307.1.32093 WP_001295307.1.3212 WP_001295307.1.32121 WP_001295307.1.32127 WP_001295307.1.32138 WP_001295307.1.32142 WP_001295307.1.32143 WP_001295307.1.3215 WP_001295307.1.32173 WP_001295307.1.32184 WP_001295307.1.322 WP_001295307.1.32222 WP_001295307.1.32225 WP_001295307.1.32232 WP_001295307.1.32234 WP_001295307.1.32236 WP_001295307.1.32242 WP_001295307.1.32243 WP_001295307.1.32279 WP_001295307.1.32287 WP_001295307.1.3233 WP_001295307.1.32333 WP_001295307.1.32394 WP_001295307.1.32406 WP_001295307.1.32432 WP_001295307.1.32435 WP_001295307.1.32443 WP_001295307.1.32448 WP_001295307.1.3247 WP_001295307.1.32475 WP_001295307.1.32478 WP_001295307.1.32479 WP_001295307.1.3248 WP_001295307.1.32480 WP_001295307.1.32494 WP_001295307.1.32509 WP_001295307.1.32518 WP_001295307.1.32536 WP_001295307.1.32558 WP_001295307.1.32561 WP_001295307.1.32574 WP_001295307.1.32580 WP_001295307.1.32587 WP_001295307.1.3259 WP_001295307.1.32590 WP_001295307.1.32591 WP_001295307.1.32601 WP_001295307.1.32635 WP_001295307.1.32650 WP_001295307.1.32661 WP_001295307.1.32676 WP_001295307.1.32680 WP_001295307.1.3269 WP_001295307.1.327 WP_001295307.1.32709 WP_001295307.1.32715 WP_001295307.1.32718 WP_001295307.1.32720 WP_001295307.1.32722 WP_001295307.1.32724 WP_001295307.1.32741 WP_001295307.1.32748 WP_001295307.1.32772 WP_001295307.1.32811 WP_001295307.1.32815 WP_001295307.1.32831 WP_001295307.1.32835 WP_001295307.1.32875 WP_001295307.1.32888 WP_001295307.1.32910 WP_001295307.1.32931 WP_001295307.1.32938 WP_001295307.1.32946 WP_001295307.1.3295 WP_001295307.1.32959 WP_001295307.1.32972 WP_001295307.1.32984 WP_001295307.1.32992 WP_001295307.1.32995 WP_001295307.1.33004 WP_001295307.1.33014 WP_001295307.1.33018 WP_001295307.1.33022 WP_001295307.1.33026 WP_001295307.1.33046 WP_001295307.1.33049 WP_001295307.1.33053 WP_001295307.1.33055 WP_001295307.1.33094 WP_001295307.1.33101 WP_001295307.1.33119 WP_001295307.1.33125 WP_001295307.1.33146 WP_001295307.1.33171 WP_001295307.1.33178 WP_001295307.1.33179 WP_001295307.1.33190 WP_001295307.1.33217 WP_001295307.1.33222 WP_001295307.1.3323 WP_001295307.1.33237 WP_001295307.1.33238 WP_001295307.1.33244 WP_001295307.1.33268 WP_001295307.1.33303 WP_001295307.1.33325 WP_001295307.1.33341 WP_001295307.1.33362 WP_001295307.1.33369 WP_001295307.1.33385 WP_001295307.1.334 WP_001295307.1.33408 WP_001295307.1.33410 WP_001295307.1.33413 WP_001295307.1.33422 WP_001295307.1.33424 WP_001295307.1.33428 WP_001295307.1.3344 WP_001295307.1.33475 WP_001295307.1.33476 WP_001295307.1.33502 WP_001295307.1.33525 WP_001295307.1.33526 WP_001295307.1.3354 WP_001295307.1.33545 WP_001295307.1.33561 WP_001295307.1.33563 WP_001295307.1.33565 WP_001295307.1.33584 WP_001295307.1.33595 WP_001295307.1.33631 WP_001295307.1.33638 WP_001295307.1.33648 WP_001295307.1.33667 WP_001295307.1.33680 WP_001295307.1.33729 WP_001295307.1.33736 WP_001295307.1.33745 WP_001295307.1.33746 WP_001295307.1.33751 WP_001295307.1.33780 WP_001295307.1.33799 WP_001295307.1.33823 WP_001295307.1.33853 WP_001295307.1.33854 WP_001295307.1.33879 WP_001295307.1.33888 WP_001295307.1.33896 WP_001295307.1.33914 WP_001295307.1.33948 WP_001295307.1.33952 WP_001295307.1.33973 WP_001295307.1.33974 WP_001295307.1.33979 WP_001295307.1.3398 WP_001295307.1.33981 WP_001295307.1.34003 WP_001295307.1.3401 WP_001295307.1.34032 WP_001295307.1.34094 WP_001295307.1.3411 WP_001295307.1.34117 WP_001295307.1.34121 WP_001295307.1.34122 WP_001295307.1.34124 WP_001295307.1.34130 WP_001295307.1.34144 WP_001295307.1.3415 WP_001295307.1.342 WP_001295307.1.34204 WP_001295307.1.34206 WP_001295307.1.34208 WP_001295307.1.34224 WP_001295307.1.34269 WP_001295307.1.34270 WP_001295307.1.34273 WP_001295307.1.34277 WP_001295307.1.34294 WP_001295307.1.34303 WP_001295307.1.3432 WP_001295307.1.34332 WP_001295307.1.34341 WP_001295307.1.34348 WP_001295307.1.34362 WP_001295307.1.34363 WP_001295307.1.34380 WP_001295307.1.34383 WP_001295307.1.3439 WP_001295307.1.34397 WP_001295307.1.34400 WP_001295307.1.34422 WP_001295307.1.3444 WP_001295307.1.34440 WP_001295307.1.34441 WP_001295307.1.34444 WP_001295307.1.34456 WP_001295307.1.34464 WP_001295307.1.34470 WP_001295307.1.34525 WP_001295307.1.34528 WP_001295307.1.34532 WP_001295307.1.34538 WP_001295307.1.34541 WP_001295307.1.34557 WP_001295307.1.34558 WP_001295307.1.3460 WP_001295307.1.34617 WP_001295307.1.34655 WP_001295307.1.34668 WP_001295307.1.34675 WP_001295307.1.34680 WP_001295307.1.34682 WP_001295307.1.34683 WP_001295307.1.34686 WP_001295307.1.3469 WP_001295307.1.347 WP_001295307.1.3472 WP_001295307.1.34727 WP_001295307.1.34763 WP_001295307.1.34781 WP_001295307.1.34782 WP_001295307.1.34794 WP_001295307.1.34827 WP_001295307.1.34835 WP_001295307.1.34838 WP_001295307.1.34855 WP_001295307.1.34875 WP_001295307.1.34887 WP_001295307.1.34913 WP_001295307.1.34931 WP_001295307.1.34966 WP_001295307.1.34982 WP_001295307.1.34983 WP_001295307.1.34990 WP_001295307.1.34993 WP_001295307.1.35006 WP_001295307.1.35007 WP_001295307.1.35012 WP_001295307.1.35107 WP_001295307.1.35114 WP_001295307.1.35127 WP_001295307.1.35132 WP_001295307.1.3515 WP_001295307.1.35168 WP_001295307.1.35180 WP_001295307.1.35186 WP_001295307.1.35195 WP_001295307.1.35198 WP_001295307.1.35202 WP_001295307.1.35204 WP_001295307.1.35208 WP_001295307.1.3521 WP_001295307.1.35253 WP_001295307.1.35258 WP_001295307.1.35316 WP_001295307.1.35328 WP_001295307.1.35360 WP_001295307.1.35365 WP_001295307.1.35368 WP_001295307.1.35376 WP_001295307.1.3539 WP_001295307.1.35394 WP_001295307.1.35398 WP_001295307.1.35448 WP_001295307.1.35464 WP_001295307.1.35465 WP_001295307.1.35466 WP_001295307.1.35483 WP_001295307.1.3550 WP_001295307.1.35552 WP_001295307.1.35578 WP_001295307.1.35581 WP_001295307.1.3560 WP_001295307.1.35604 WP_001295307.1.35627 WP_001295307.1.35649 WP_001295307.1.35651 WP_001295307.1.35653 WP_001295307.1.35654 WP_001295307.1.35698 WP_001295307.1.35704 WP_001295307.1.35724 WP_001295307.1.35740 WP_001295307.1.35741 WP_001295307.1.35744 WP_001295307.1.35789 WP_001295307.1.35889 WP_001295307.1.35904 WP_001295307.1.35922 WP_001295307.1.35927 WP_001295307.1.35934 WP_001295307.1.35942 WP_001295307.1.35959 WP_001295307.1.35963 WP_001295307.1.35983 WP_001295307.1.35987 WP_001295307.1.35990 WP_001295307.1.3600 WP_001295307.1.36010 WP_001295307.1.36040 WP_001295307.1.36042 WP_001295307.1.36070 WP_001295307.1.36071 WP_001295307.1.36085 WP_001295307.1.36105 WP_001295307.1.36129 WP_001295307.1.36132 WP_001295307.1.36158 WP_001295307.1.36159 WP_001295307.1.36164 WP_001295307.1.36166 WP_001295307.1.36177 WP_001295307.1.36182 WP_001295307.1.3620 WP_001295307.1.36207 WP_001295307.1.36212 WP_001295307.1.3624 WP_001295307.1.36281 WP_001295307.1.36299 WP_001295307.1.36332 WP_001295307.1.36334 WP_001295307.1.36352 WP_001295307.1.36386 WP_001295307.1.36393 WP_001295307.1.36405 WP_001295307.1.36412 WP_001295307.1.36414 WP_001295307.1.36426 WP_001295307.1.3643 WP_001295307.1.36453 WP_001295307.1.36459 WP_001295307.1.36496 WP_001295307.1.365 WP_001295307.1.36500 WP_001295307.1.36507 WP_001295307.1.36523 WP_001295307.1.36531 WP_001295307.1.36537 WP_001295307.1.36545 WP_001295307.1.36610 WP_001295307.1.36626 WP_001295307.1.36627 WP_001295307.1.36628 WP_001295307.1.36667 WP_001295307.1.3668 WP_001295307.1.36699 WP_001295307.1.36707 WP_001295307.1.3671 WP_001295307.1.36724 WP_001295307.1.36739 WP_001295307.1.36746 WP_001295307.1.36747 WP_001295307.1.36761 WP_001295307.1.36767 WP_001295307.1.36799 WP_001295307.1.36806 WP_001295307.1.36812 WP_001295307.1.36826 WP_001295307.1.36833 WP_001295307.1.36856 WP_001295307.1.36886 WP_001295307.1.36904 WP_001295307.1.36925 WP_001295307.1.3697 WP_001295307.1.36971 WP_001295307.1.36975 WP_001295307.1.37006 WP_001295307.1.37020 WP_001295307.1.37032 WP_001295307.1.37046 WP_001295307.1.37049 WP_001295307.1.37057 WP_001295307.1.37076 WP_001295307.1.37101 WP_001295307.1.37102 WP_001295307.1.37103 WP_001295307.1.37122 WP_001295307.1.37146 WP_001295307.1.37153 WP_001295307.1.37155 WP_001295307.1.37206 WP_001295307.1.37226 WP_001295307.1.3723 WP_001295307.1.37233 WP_001295307.1.37252 WP_001295307.1.37261 WP_001295307.1.37266 WP_001295307.1.3730 WP_001295307.1.37306 WP_001295307.1.37312 WP_001295307.1.37313 WP_001295307.1.37329 WP_001295307.1.37334 WP_001295307.1.37337 WP_001295307.1.37342 WP_001295307.1.37352 WP_001295307.1.37360 WP_001295307.1.37371 WP_001295307.1.37372 WP_001295307.1.37388 WP_001295307.1.37419 WP_001295307.1.37423 WP_001295307.1.37433 WP_001295307.1.37445 WP_001295307.1.37472 WP_001295307.1.37476 WP_001295307.1.37477 WP_001295307.1.37485 WP_001295307.1.3749 WP_001295307.1.37510 WP_001295307.1.37516 WP_001295307.1.37538 WP_001295307.1.37543 WP_001295307.1.37544 WP_001295307.1.37548 WP_001295307.1.37549 WP_001295307.1.37550 WP_001295307.1.37554 WP_001295307.1.37576 WP_001295307.1.37588 WP_001295307.1.37592 WP_001295307.1.37608 WP_001295307.1.3762 WP_001295307.1.37634 WP_001295307.1.37637 WP_001295307.1.37664 WP_001295307.1.377 WP_001295307.1.3772 WP_001295307.1.37730 WP_001295307.1.37731 WP_001295307.1.37736 WP_001295307.1.37745 WP_001295307.1.37750 WP_001295307.1.37758 WP_001295307.1.37762 WP_001295307.1.37766 WP_001295307.1.37769 WP_001295307.1.37773 WP_001295307.1.37817 WP_001295307.1.37830 WP_001295307.1.37847 WP_001295307.1.37852 WP_001295307.1.37853 WP_001295307.1.3788 WP_001295307.1.37880 WP_001295307.1.37887 WP_001295307.1.37897 WP_001295307.1.37917 WP_001295307.1.37923 WP_001295307.1.37926 WP_001295307.1.37940 WP_001295307.1.3795 WP_001295307.1.3796 WP_001295307.1.37962 WP_001295307.1.37964 WP_001295307.1.37984 WP_001295307.1.37995 WP_001295307.1.37998 WP_001295307.1.38000 WP_001295307.1.38033 WP_001295307.1.38043 WP_001295307.1.38050 WP_001295307.1.38063 WP_001295307.1.38080 WP_001295307.1.38085 WP_001295307.1.38103 WP_001295307.1.38105 WP_001295307.1.38107 WP_001295307.1.3811 WP_001295307.1.38119 WP_001295307.1.38120 WP_001295307.1.3815 WP_001295307.1.38162 WP_001295307.1.38182 WP_001295307.1.38185 WP_001295307.1.38194 WP_001295307.1.38202 WP_001295307.1.38211 WP_001295307.1.3822 WP_001295307.1.38234 WP_001295307.1.38257 WP_001295307.1.38264 WP_001295307.1.38293 WP_001295307.1.38300 WP_001295307.1.38306 WP_001295307.1.38314 WP_001295307.1.38323 WP_001295307.1.38357 WP_001295307.1.38371 WP_001295307.1.38392 WP_001295307.1.38412 WP_001295307.1.38419 WP_001295307.1.38485 WP_001295307.1.38533 WP_001295307.1.38544 WP_001295307.1.38561 WP_001295307.1.38567 WP_001295307.1.38584 WP_001295307.1.38610 WP_001295307.1.38626 WP_001295307.1.38629 WP_001295307.1.38636 WP_001295307.1.38694 WP_001295307.1.38722 WP_001295307.1.3873 WP_001295307.1.38751 WP_001295307.1.38777 WP_001295307.1.38782 WP_001295307.1.38811 WP_001295307.1.38827 WP_001295307.1.38843 WP_001295307.1.38896 WP_001295307.1.389 WP_001295307.1.38911 WP_001295307.1.38920 WP_001295307.1.38935 WP_001295307.1.38937 WP_001295307.1.38950 WP_001295307.1.38956 WP_001295307.1.38958 WP_001295307.1.39005 WP_001295307.1.39015 WP_001295307.1.3903 WP_001295307.1.39037 WP_001295307.1.3904 WP_001295307.1.39042 WP_001295307.1.39063 WP_001295307.1.39103 WP_001295307.1.39111 WP_001295307.1.3912 WP_001295307.1.39123 WP_001295307.1.39148 WP_001295307.1.39150 WP_001295307.1.39155 WP_001295307.1.39157 WP_001295307.1.39164 WP_001295307.1.39167 WP_001295307.1.39171 WP_001295307.1.39180 WP_001295307.1.39184 WP_001295307.1.39196 WP_001295307.1.39209 WP_001295307.1.3921 WP_001295307.1.3922 WP_001295307.1.39232 WP_001295307.1.39249 WP_001295307.1.39254 WP_001295307.1.39289 WP_001295307.1.39305 WP_001295307.1.39310 WP_001295307.1.39313 WP_001295307.1.39325 WP_001295307.1.39327 WP_001295307.1.39342 WP_001295307.1.39356 WP_001295307.1.39358 WP_001295307.1.39365 WP_001295307.1.39373 WP_001295307.1.39377 WP_001295307.1.39401 WP_001295307.1.39402 WP_001295307.1.39415 WP_001295307.1.39423 WP_001295307.1.39430 WP_001295307.1.39468 WP_001295307.1.39492 WP_001295307.1.39509 WP_001295307.1.39531 WP_001295307.1.3954 WP_001295307.1.39541 WP_001295307.1.39564 WP_001295307.1.39575 WP_001295307.1.39580 WP_001295307.1.39594 WP_001295307.1.39601 WP_001295307.1.39606 WP_001295307.1.39607 WP_001295307.1.39610 WP_001295307.1.39626 WP_001295307.1.39636 WP_001295307.1.39646 WP_001295307.1.39651 WP_001295307.1.39690 WP_001295307.1.3970 WP_001295307.1.39708 WP_001295307.1.39709 WP_001295307.1.39713 WP_001295307.1.39715 WP_001295307.1.39717 WP_001295307.1.39726 WP_001295307.1.39730 WP_001295307.1.39734 WP_001295307.1.39758 WP_001295307.1.39780 WP_001295307.1.39796 WP_001295307.1.3980 WP_001295307.1.39809 WP_001295307.1.39818 WP_001295307.1.39820 WP_001295307.1.39822 WP_001295307.1.39829 WP_001295307.1.39867 WP_001295307.1.39870 WP_001295307.1.39892 WP_001295307.1.39938 WP_001295307.1.39961 WP_001295307.1.39966 WP_001295307.1.39970 WP_001295307.1.39973 WP_001295307.1.39992 WP_001295307.1.39998 WP_001295307.1.40 WP_001295307.1.40013 WP_001295307.1.40016 WP_001295307.1.40019 WP_001295307.1.4005 WP_001295307.1.40083 WP_001295307.1.40088 WP_001295307.1.40107 WP_001295307.1.40113 WP_001295307.1.40121 WP_001295307.1.40140 WP_001295307.1.40147 WP_001295307.1.40153 WP_001295307.1.40159 WP_001295307.1.40183 WP_001295307.1.40190 WP_001295307.1.40192 WP_001295307.1.4020 WP_001295307.1.40206 WP_001295307.1.40211 WP_001295307.1.40212 WP_001295307.1.40218 WP_001295307.1.40234 WP_001295307.1.40238 WP_001295307.1.40249 WP_001295307.1.40298 WP_001295307.1.4030 WP_001295307.1.40300 WP_001295307.1.40315 WP_001295307.1.40317 WP_001295307.1.40319 WP_001295307.1.40335 WP_001295307.1.40345 WP_001295307.1.40349 WP_001295307.1.40360 WP_001295307.1.40382 WP_001295307.1.40389 WP_001295307.1.40391 WP_001295307.1.40403 WP_001295307.1.40445 WP_001295307.1.40486 WP_001295307.1.4049 WP_001295307.1.40499 WP_001295307.1.40502 WP_001295307.1.40509 WP_001295307.1.40524 WP_001295307.1.40539 WP_001295307.1.40548 WP_001295307.1.40549 WP_001295307.1.40560 WP_001295307.1.40563 WP_001295307.1.40596 WP_001295307.1.40599 WP_001295307.1.406 WP_001295307.1.40607 WP_001295307.1.40617 WP_001295307.1.40623 WP_001295307.1.40629 WP_001295307.1.40636 WP_001295307.1.40660 WP_001295307.1.40666 WP_001295307.1.40668 WP_001295307.1.40686 WP_001295307.1.40712 WP_001295307.1.40715 WP_001295307.1.40742 WP_001295307.1.40758 WP_001295307.1.40781 WP_001295307.1.40793 WP_001295307.1.4081 WP_001295307.1.40813 WP_001295307.1.40815 WP_001295307.1.4082 WP_001295307.1.40833 WP_001295307.1.40842 WP_001295307.1.40843 WP_001295307.1.40865 WP_001295307.1.40882 WP_001295307.1.40893 WP_001295307.1.40898 WP_001295307.1.40900 WP_001295307.1.40912 WP_001295307.1.40937 WP_001295307.1.40952 WP_001295307.1.40965 WP_001295307.1.4103 WP_001295307.1.41037 WP_001295307.1.41041 WP_001295307.1.41045 WP_001295307.1.41060 WP_001295307.1.41063 WP_001295307.1.41078 WP_001295307.1.41113 WP_001295307.1.41125 WP_001295307.1.41206 WP_001295307.1.4122 WP_001295307.1.41230 WP_001295307.1.41239 WP_001295307.1.41244 WP_001295307.1.41259 WP_001295307.1.4126 WP_001295307.1.41263 WP_001295307.1.41287 WP_001295307.1.41294 WP_001295307.1.41315 WP_001295307.1.41330 WP_001295307.1.41332 WP_001295307.1.41339 WP_001295307.1.41346 WP_001295307.1.41363 WP_001295307.1.41368 WP_001295307.1.41371 WP_001295307.1.41392 WP_001295307.1.41394 WP_001295307.1.41401 WP_001295307.1.41402 WP_001295307.1.41407 WP_001295307.1.4142 WP_001295307.1.41436 WP_001295307.1.41449 WP_001295307.1.41453 WP_001295307.1.41455 WP_001295307.1.41457 WP_001295307.1.41466 WP_001295307.1.41478 WP_001295307.1.41479 WP_001295307.1.41481 WP_001295307.1.41482 WP_001295307.1.41483 WP_001295307.1.41484 WP_001295307.1.41488 WP_001295307.1.41513 WP_001295307.1.41530 WP_001295307.1.41536 WP_001295307.1.41545 WP_001295307.1.41566 WP_001295307.1.4158 WP_001295307.1.41606 WP_001295307.1.41613 WP_001295307.1.41621 WP_001295307.1.41654 WP_001295307.1.41712 WP_001295307.1.41718 WP_001295307.1.41734 WP_001295307.1.41741 WP_001295307.1.41752 WP_001295307.1.41778 WP_001295307.1.41780 WP_001295307.1.41783 WP_001295307.1.41809 WP_001295307.1.41812 WP_001295307.1.41813 WP_001295307.1.41822 WP_001295307.1.41826 WP_001295307.1.41837 WP_001295307.1.41847 WP_001295307.1.41849 WP_001295307.1.41884 WP_001295307.1.41885 WP_001295307.1.4189 WP_001295307.1.41900 WP_001295307.1.41923 WP_001295307.1.4193 WP_001295307.1.41956 WP_001295307.1.41960 WP_001295307.1.41964 WP_001295307.1.41988 WP_001295307.1.41990 WP_001295307.1.41991 WP_001295307.1.42022 WP_001295307.1.42027 WP_001295307.1.42033 WP_001295307.1.42036 WP_001295307.1.42038 WP_001295307.1.42044 WP_001295307.1.42073 WP_001295307.1.42095 WP_001295307.1.42096 WP_001295307.1.42113 WP_001295307.1.4213 WP_001295307.1.42138 WP_001295307.1.4214 WP_001295307.1.42151 WP_001295307.1.42159 WP_001295307.1.42179 WP_001295307.1.42191 WP_001295307.1.42203 WP_001295307.1.42209 WP_001295307.1.42214 WP_001295307.1.42221 WP_001295307.1.42226 WP_001295307.1.42228 WP_001295307.1.42233 WP_001295307.1.4224 WP_001295307.1.42252 WP_001295307.1.42258 WP_001295307.1.42277 WP_001295307.1.42284 WP_001295307.1.42300 WP_001295307.1.42318 WP_001295307.1.42350 WP_001295307.1.42359 WP_001295307.1.42367 WP_001295307.1.42369 WP_001295307.1.42376 WP_001295307.1.42387 WP_001295307.1.42413 WP_001295307.1.42415 WP_001295307.1.42432 WP_001295307.1.42442 WP_001295307.1.42443 WP_001295307.1.42447 WP_001295307.1.42448 WP_001295307.1.42456 WP_001295307.1.42480 WP_001295307.1.4250 WP_001295307.1.42513 WP_001295307.1.42516 WP_001295307.1.42522 WP_001295307.1.42547 WP_001295307.1.42586 WP_001295307.1.42594 WP_001295307.1.42597 WP_001295307.1.42600 WP_001295307.1.42601 WP_001295307.1.4261 WP_001295307.1.42632 WP_001295307.1.42638 WP_001295307.1.42661 WP_001295307.1.42669 WP_001295307.1.42670 WP_001295307.1.42677 WP_001295307.1.42709 WP_001295307.1.42728 WP_001295307.1.42748 WP_001295307.1.42749 WP_001295307.1.42750 WP_001295307.1.42756 WP_001295307.1.42761 WP_001295307.1.42770 WP_001295307.1.42771 WP_001295307.1.42791 WP_001295307.1.42804 WP_001295307.1.42808 WP_001295307.1.42813 WP_001295307.1.4282 WP_001295307.1.42828 WP_001295307.1.42830 WP_001295307.1.42832 WP_001295307.1.42863 WP_001295307.1.42879 WP_001295307.1.42891 WP_001295307.1.4290 WP_001295307.1.42918 WP_001295307.1.42936 WP_001295307.1.42937 WP_001295307.1.42950 WP_001295307.1.42962 WP_001295307.1.42966 WP_001295307.1.42970 WP_001295307.1.42987 WP_001295307.1.42989 WP_001295307.1.42991 WP_001295307.1.43013 WP_001295307.1.43027 WP_001295307.1.43035 WP_001295307.1.4306 WP_001295307.1.43079 WP_001295307.1.43121 WP_001295307.1.43123 WP_001295307.1.4313 WP_001295307.1.43132 WP_001295307.1.43133 WP_001295307.1.43137 WP_001295307.1.43140 WP_001295307.1.43166 WP_001295307.1.43170 WP_001295307.1.43174 WP_001295307.1.43177 WP_001295307.1.43196 WP_001295307.1.43213 WP_001295307.1.43216 WP_001295307.1.43239 WP_001295307.1.43270 WP_001295307.1.43278 WP_001295307.1.43316 WP_001295307.1.43324 WP_001295307.1.4334 WP_001295307.1.43363 WP_001295307.1.43374 WP_001295307.1.43384 WP_001295307.1.43389 WP_001295307.1.4342 WP_001295307.1.43422 WP_001295307.1.43427 WP_001295307.1.4343 WP_001295307.1.43444 WP_001295307.1.43448 WP_001295307.1.43455 WP_001295307.1.43469 WP_001295307.1.43473 WP_001295307.1.43474 WP_001295307.1.43489 WP_001295307.1.43501 WP_001295307.1.43536 WP_001295307.1.4356 WP_001295307.1.43561 WP_001295307.1.43566 WP_001295307.1.43604 WP_001295307.1.43622 WP_001295307.1.43720 WP_001295307.1.43733 WP_001295307.1.43738 WP_001295307.1.43750 WP_001295307.1.43754 WP_001295307.1.43769 WP_001295307.1.43798 WP_001295307.1.43803 WP_001295307.1.43804 WP_001295307.1.43837 WP_001295307.1.43858 WP_001295307.1.43868 WP_001295307.1.43898 WP_001295307.1.43911 WP_001295307.1.43918 WP_001295307.1.43925 WP_001295307.1.43939 WP_001295307.1.43942 WP_001295307.1.43953 WP_001295307.1.43966 WP_001295307.1.43989 WP_001295307.1.440 WP_001295307.1.4400 WP_001295307.1.44018 WP_001295307.1.44020 WP_001295307.1.44029 WP_001295307.1.44040 WP_001295307.1.44051 WP_001295307.1.44075 WP_001295307.1.44077 WP_001295307.1.44088 WP_001295307.1.44100 WP_001295307.1.4411 WP_001295307.1.44115 WP_001295307.1.44125 WP_001295307.1.44130 WP_001295307.1.4415 WP_001295307.1.44162 WP_001295307.1.44165 WP_001295307.1.44166 WP_001295307.1.44201 WP_001295307.1.44211 WP_001295307.1.44222 WP_001295307.1.44263 WP_001295307.1.44264 WP_001295307.1.44273 WP_001295307.1.44285 WP_001295307.1.44287 WP_001295307.1.44292 WP_001295307.1.44314 WP_001295307.1.44324 WP_001295307.1.44327 WP_001295307.1.44354 WP_001295307.1.44365 WP_001295307.1.44394 WP_001295307.1.44422 WP_001295307.1.44424 WP_001295307.1.44426 WP_001295307.1.44445 WP_001295307.1.44447 WP_001295307.1.4445 WP_001295307.1.44460 WP_001295307.1.44488 WP_001295307.1.4449 WP_001295307.1.44524 WP_001295307.1.44539 WP_001295307.1.4454 WP_001295307.1.44561 WP_001295307.1.44587 WP_001295307.1.4459 WP_001295307.1.44608 WP_001295307.1.44610 WP_001295307.1.44622 WP_001295307.1.44627 WP_001295307.1.4463 WP_001295307.1.44642 WP_001295307.1.44649 WP_001295307.1.44661 WP_001295307.1.44668 WP_001295307.1.44671 WP_001295307.1.44686 WP_001295307.1.4471 WP_001295307.1.44717 WP_001295307.1.44724 WP_001295307.1.4473 WP_001295307.1.44733 WP_001295307.1.44756 WP_001295307.1.44759 WP_001295307.1.44784 WP_001295307.1.448 WP_001295307.1.44800 WP_001295307.1.44814 WP_001295307.1.44818 WP_001295307.1.44821 WP_001295307.1.44836 WP_001295307.1.44841 WP_001295307.1.44843 WP_001295307.1.44848 WP_001295307.1.44849 WP_001295307.1.44854 WP_001295307.1.44855 WP_001295307.1.44857 WP_001295307.1.44906 WP_001295307.1.44923 WP_001295307.1.44954 WP_001295307.1.44960 WP_001295307.1.44961 WP_001295307.1.44970 WP_001295307.1.44975 WP_001295307.1.44977 WP_001295307.1.44980 WP_001295307.1.45000 WP_001295307.1.45020 WP_001295307.1.45025 WP_001295307.1.45028 WP_001295307.1.45043 WP_001295307.1.45053 WP_001295307.1.45068 WP_001295307.1.45076 WP_001295307.1.45104 WP_001295307.1.45116 WP_001295307.1.45153 WP_001295307.1.45156 WP_001295307.1.4516 WP_001295307.1.45190 WP_001295307.1.45195 WP_001295307.1.45208 WP_001295307.1.4524 WP_001295307.1.45246 WP_001295307.1.45293 WP_001295307.1.4530 WP_001295307.1.45301 WP_001295307.1.45313 WP_001295307.1.45329 WP_001295307.1.4535 WP_001295307.1.45359 WP_001295307.1.4538 WP_001295307.1.45392 WP_001295307.1.45405 WP_001295307.1.4541 WP_001295307.1.45440 WP_001295307.1.45444 WP_001295307.1.45486 WP_001295307.1.4549 WP_001295307.1.45494 WP_001295307.1.45500 WP_001295307.1.45525 WP_001295307.1.45536 WP_001295307.1.45565 WP_001295307.1.45575 WP_001295307.1.45581 WP_001295307.1.45595 WP_001295307.1.45600 WP_001295307.1.45627 WP_001295307.1.4563 WP_001295307.1.45664 WP_001295307.1.45674 WP_001295307.1.45676 WP_001295307.1.4570 WP_001295307.1.45707 WP_001295307.1.45718 WP_001295307.1.4574 WP_001295307.1.45740 WP_001295307.1.45741 WP_001295307.1.45752 WP_001295307.1.4576 WP_001295307.1.45789 WP_001295307.1.45799 WP_001295307.1.45801 WP_001295307.1.45806 WP_001295307.1.4583 WP_001295307.1.45840 WP_001295307.1.45841 WP_001295307.1.45846 WP_001295307.1.45865 WP_001295307.1.45868 WP_001295307.1.45891 WP_001295307.1.45901 WP_001295307.1.45921 WP_001295307.1.4593 WP_001295307.1.45930 WP_001295307.1.45931 WP_001295307.1.45933 WP_001295307.1.45941 WP_001295307.1.45945 WP_001295307.1.45949 WP_001295307.1.45960 WP_001295307.1.45962 WP_001295307.1.45968 WP_001295307.1.45990 WP_001295307.1.45991 WP_001295307.1.4600 WP_001295307.1.46026 WP_001295307.1.46027 WP_001295307.1.46039 WP_001295307.1.46049 WP_001295307.1.46070 WP_001295307.1.46081 WP_001295307.1.46097 WP_001295307.1.4610 WP_001295307.1.46105 WP_001295307.1.46115 WP_001295307.1.4613 WP_001295307.1.46164 WP_001295307.1.4617 WP_001295307.1.46186 WP_001295307.1.4619 WP_001295307.1.46197 WP_001295307.1.46213 WP_001295307.1.46217 WP_001295307.1.46239 WP_001295307.1.46245 WP_001295307.1.46257 WP_001295307.1.46263 WP_001295307.1.46282 WP_001295307.1.46283 WP_001295307.1.46291 WP_001295307.1.46301 WP_001295307.1.46325 WP_001295307.1.46329 WP_001295307.1.46369 WP_001295307.1.46378 WP_001295307.1.46414 WP_001295307.1.46429 WP_001295307.1.4643 WP_001295307.1.46433 WP_001295307.1.46438 WP_001295307.1.46441 WP_001295307.1.46451 WP_001295307.1.4646 WP_001295307.1.46468 WP_001295307.1.4647 WP_001295307.1.46477 WP_001295307.1.46487 WP_001295307.1.46503 WP_001295307.1.46526 WP_001295307.1.46531 WP_001295307.1.46541 WP_001295307.1.46552 WP_001295307.1.46555 WP_001295307.1.46573 WP_001295307.1.46582 WP_001295307.1.46589 WP_001295307.1.46594 WP_001295307.1.46597 WP_001295307.1.46602 WP_001295307.1.46611 WP_001295307.1.46614 WP_001295307.1.46616 WP_001295307.1.46626 WP_001295307.1.46643 WP_001295307.1.46668 WP_001295307.1.4670 WP_001295307.1.46734 WP_001295307.1.46795 WP_001295307.1.46798 WP_001295307.1.46802 WP_001295307.1.46806 WP_001295307.1.46810 WP_001295307.1.46820 WP_001295307.1.46821 WP_001295307.1.46832 WP_001295307.1.46833 WP_001295307.1.46841 WP_001295307.1.46857 WP_001295307.1.46860 WP_001295307.1.46876 WP_001295307.1.46882 WP_001295307.1.46898 WP_001295307.1.46909 WP_001295307.1.4691 WP_001295307.1.46912 WP_001295307.1.46913 WP_001295307.1.46932 WP_001295307.1.4695 WP_001295307.1.46990 WP_001295307.1.46991 WP_001295307.1.46994 WP_001295307.1.46999 WP_001295307.1.47024 WP_001295307.1.47028 WP_001295307.1.47029 WP_001295307.1.47030 WP_001295307.1.47034 WP_001295307.1.47038 WP_001295307.1.47039 WP_001295307.1.47047 WP_001295307.1.47048 WP_001295307.1.47050 WP_001295307.1.47054 WP_001295307.1.47063 WP_001295307.1.47073 WP_001295307.1.4708 WP_001295307.1.47124 WP_001295307.1.47135 WP_001295307.1.47140 WP_001295307.1.47156 WP_001295307.1.47167 WP_001295307.1.47171 WP_001295307.1.47186 WP_001295307.1.47189 WP_001295307.1.47197 WP_001295307.1.4722 WP_001295307.1.47224 WP_001295307.1.4723 WP_001295307.1.47235 WP_001295307.1.47246 WP_001295307.1.47247 WP_001295307.1.4725 WP_001295307.1.47280 WP_001295307.1.47307 WP_001295307.1.47316 WP_001295307.1.47319 WP_001295307.1.47322 WP_001295307.1.47332 WP_001295307.1.47344 WP_001295307.1.47349 WP_001295307.1.47350 WP_001295307.1.47356 WP_001295307.1.47363 WP_001295307.1.47366 WP_001295307.1.47370 WP_001295307.1.47386 WP_001295307.1.47398 WP_001295307.1.4740 WP_001295307.1.47401 WP_001295307.1.47411 WP_001295307.1.47414 WP_001295307.1.47416 WP_001295307.1.47425 WP_001295307.1.4743 WP_001295307.1.47451 WP_001295307.1.47454 WP_001295307.1.47464 WP_001295307.1.47473 WP_001295307.1.47477 WP_001295307.1.47488 WP_001295307.1.47496 WP_001295307.1.47498 WP_001295307.1.47500 WP_001295307.1.47529 WP_001295307.1.47533 WP_001295307.1.47546 WP_001295307.1.47582 WP_001295307.1.47599 WP_001295307.1.47634 WP_001295307.1.47646 WP_001295307.1.47654 WP_001295307.1.47662 WP_001295307.1.47673 WP_001295307.1.47709 WP_001295307.1.4772 WP_001295307.1.47722 WP_001295307.1.4773 WP_001295307.1.47734 WP_001295307.1.47740 WP_001295307.1.47744 WP_001295307.1.47761 WP_001295307.1.47764 WP_001295307.1.47765 WP_001295307.1.47770 WP_001295307.1.47775 WP_001295307.1.47784 WP_001295307.1.47790 WP_001295307.1.47791 WP_001295307.1.47820 WP_001295307.1.47827 WP_001295307.1.4783 WP_001295307.1.47848 WP_001295307.1.4785 WP_001295307.1.47884 WP_001295307.1.47914 WP_001295307.1.47935 WP_001295307.1.47954 WP_001295307.1.4796 WP_001295307.1.47962 WP_001295307.1.47976 WP_001295307.1.47981 WP_001295307.1.47983 WP_001295307.1.47994 WP_001295307.1.48000 WP_001295307.1.48018 WP_001295307.1.48029 WP_001295307.1.48040 WP_001295307.1.48048 WP_001295307.1.48051 WP_001295307.1.48065 WP_001295307.1.48073 WP_001295307.1.48077 WP_001295307.1.48080 WP_001295307.1.48087 WP_001295307.1.48090 WP_001295307.1.48096 WP_001295307.1.4811 WP_001295307.1.48111 WP_001295307.1.4812 WP_001295307.1.48121 WP_001295307.1.48144 WP_001295307.1.48168 WP_001295307.1.48176 WP_001295307.1.48188 WP_001295307.1.48194 WP_001295307.1.48203 WP_001295307.1.48216 WP_001295307.1.48222 WP_001295307.1.48226 WP_001295307.1.48229 WP_001295307.1.4826 WP_001295307.1.48265 WP_001295307.1.48285 WP_001295307.1.48290 WP_001295307.1.48291 WP_001295307.1.48317 WP_001295307.1.48353 WP_001295307.1.48355 WP_001295307.1.48371 WP_001295307.1.48385 WP_001295307.1.48404 WP_001295307.1.48417 WP_001295307.1.48421 WP_001295307.1.48431 WP_001295307.1.48433 WP_001295307.1.48469 WP_001295307.1.48477 WP_001295307.1.48480 WP_001295307.1.48483 WP_001295307.1.48522 WP_001295307.1.4857 WP_001295307.1.48571 WP_001295307.1.48590 WP_001295307.1.486 WP_001295307.1.48602 WP_001295307.1.48615 WP_001295307.1.48620 WP_001295307.1.48626 WP_001295307.1.48629 WP_001295307.1.48689 WP_001295307.1.48697 WP_001295307.1.4871 WP_001295307.1.48712 WP_001295307.1.48771 WP_001295307.1.48792 WP_001295307.1.48801 WP_001295307.1.48806 WP_001295307.1.48808 WP_001295307.1.48825 WP_001295307.1.48827 WP_001295307.1.48847 WP_001295307.1.48860 WP_001295307.1.48901 WP_001295307.1.48902 WP_001295307.1.48907 WP_001295307.1.48910 WP_001295307.1.4892 WP_001295307.1.48921 WP_001295307.1.48926 WP_001295307.1.48928 WP_001295307.1.48953 WP_001295307.1.48954 WP_001295307.1.48970 WP_001295307.1.48974 WP_001295307.1.49001 WP_001295307.1.49009 WP_001295307.1.49061 WP_001295307.1.49076 WP_001295307.1.49107 WP_001295307.1.49124 WP_001295307.1.49136 WP_001295307.1.49147 WP_001295307.1.49170 WP_001295307.1.49179 WP_001295307.1.49190 WP_001295307.1.49229 WP_001295307.1.49236 WP_001295307.1.49243 WP_001295307.1.49258 WP_001295307.1.49259 WP_001295307.1.49275 WP_001295307.1.4931 WP_001295307.1.49312 WP_001295307.1.49321 WP_001295307.1.49332 WP_001295307.1.49336 WP_001295307.1.49338 WP_001295307.1.49342 WP_001295307.1.49347 WP_001295307.1.49363 WP_001295307.1.49401 WP_001295307.1.49431 WP_001295307.1.49446 WP_001295307.1.49464 WP_001295307.1.49481 WP_001295307.1.49482 WP_001295307.1.49483 WP_001295307.1.4949 WP_001295307.1.49521 WP_001295307.1.49522 WP_001295307.1.49528 WP_001295307.1.4953 WP_001295307.1.49531 WP_001295307.1.49537 WP_001295307.1.49546 WP_001295307.1.49567 WP_001295307.1.49594 WP_001295307.1.49599 WP_001295307.1.49615 WP_001295307.1.49621 WP_001295307.1.49625 WP_001295307.1.49645 WP_001295307.1.49661 WP_001295307.1.49662 WP_001295307.1.49675 WP_001295307.1.49684 WP_001295307.1.497 WP_001295307.1.49712 WP_001295307.1.49722 WP_001295307.1.49733 WP_001295307.1.49740 WP_001295307.1.49747 WP_001295307.1.49768 WP_001295307.1.49774 WP_001295307.1.49777 WP_001295307.1.49783 WP_001295307.1.49788 WP_001295307.1.49794 WP_001295307.1.49820 WP_001295307.1.49823 WP_001295307.1.4985 WP_001295307.1.49856 WP_001295307.1.49861 WP_001295307.1.49879 WP_001295307.1.49883 WP_001295307.1.49884 WP_001295307.1.49900 WP_001295307.1.49902 WP_001295307.1.49941 WP_001295307.1.49950 WP_001295307.1.49954 WP_001295307.1.49972 WP_001295307.1.49987 WP_001295307.1.50006 WP_001295307.1.50008 WP_001295307.1.5003 WP_001295307.1.50036 WP_001295307.1.50056 WP_001295307.1.50058 WP_001295307.1.50078 WP_001295307.1.50098 WP_001295307.1.50110 WP_001295307.1.50113 WP_001295307.1.50119 WP_001295307.1.50136 WP_001295307.1.50146 WP_001295307.1.5017 WP_001295307.1.50179 WP_001295307.1.50182 WP_001295307.1.50187 WP_001295307.1.50191 WP_001295307.1.50196 WP_001295307.1.50207 WP_001295307.1.50228 WP_001295307.1.50230 WP_001295307.1.50258 WP_001295307.1.50262 WP_001295307.1.50266 WP_001295307.1.50269 WP_001295307.1.50270 WP_001295307.1.50273 WP_001295307.1.50278 WP_001295307.1.50329 WP_001295307.1.50345 WP_001295307.1.50353 WP_001295307.1.50358 WP_001295307.1.50361 WP_001295307.1.50366 WP_001295307.1.5037 WP_001295307.1.50380 WP_001295307.1.50381 WP_001295307.1.5040 WP_001295307.1.5041 WP_001295307.1.50412 WP_001295307.1.50418 WP_001295307.1.50427 WP_001295307.1.50446 WP_001295307.1.50452 WP_001295307.1.5046 WP_001295307.1.50539 WP_001295307.1.50548 WP_001295307.1.50549 WP_001295307.1.5056 WP_001295307.1.50564 WP_001295307.1.50579 WP_001295307.1.50585 WP_001295307.1.50586 WP_001295307.1.506 WP_001295307.1.50608 WP_001295307.1.5061 WP_001295307.1.50616 WP_001295307.1.50627 WP_001295307.1.5064 WP_001295307.1.5067 WP_001295307.1.50690 WP_001295307.1.50700 WP_001295307.1.50715 WP_001295307.1.50717 WP_001295307.1.50725 WP_001295307.1.50728 WP_001295307.1.50762 WP_001295307.1.50887 WP_001295307.1.50936 WP_001295307.1.50939 WP_001295307.1.50947 WP_001295307.1.5095 WP_001295307.1.50957 WP_001295307.1.50969 WP_001295307.1.50986 WP_001295307.1.50988 WP_001295307.1.50990 WP_001295307.1.50993 WP_001295307.1.50996 WP_001295307.1.51013 WP_001295307.1.51027 WP_001295307.1.51058 WP_001295307.1.5106 WP_001295307.1.511 WP_001295307.1.51127 WP_001295307.1.51154 WP_001295307.1.51170 WP_001295307.1.51171 WP_001295307.1.51172 WP_001295307.1.51175 WP_001295307.1.51180 WP_001295307.1.51190 WP_001295307.1.51201 WP_001295307.1.51203 WP_001295307.1.51206 WP_001295307.1.51211 WP_001295307.1.5124 WP_001295307.1.51248 WP_001295307.1.51253 WP_001295307.1.51255 WP_001295307.1.51260 WP_001295307.1.51278 WP_001295307.1.5128 WP_001295307.1.51283 WP_001295307.1.51299 WP_001295307.1.51300 WP_001295307.1.51320 WP_001295307.1.51323 WP_001295307.1.51325 WP_001295307.1.51330 WP_001295307.1.51336 WP_001295307.1.51354 WP_001295307.1.51360 WP_001295307.1.51364 WP_001295307.1.51380 WP_001295307.1.51392 WP_001295307.1.51405 WP_001295307.1.51425 WP_001295307.1.51426 WP_001295307.1.51427 WP_001295307.1.51430 WP_001295307.1.5146 WP_001295307.1.51482 WP_001295307.1.51495 WP_001295307.1.51503 WP_001295307.1.51505 WP_001295307.1.51513 WP_001295307.1.51525 WP_001295307.1.5153 WP_001295307.1.51537 WP_001295307.1.51539 WP_001295307.1.51542 WP_001295307.1.51552 WP_001295307.1.5158 WP_001295307.1.51580 WP_001295307.1.51587 WP_001295307.1.51596 WP_001295307.1.51600 WP_001295307.1.51607 WP_001295307.1.51624 WP_001295307.1.51629 WP_001295307.1.51643 WP_001295307.1.51662 WP_001295307.1.51690 WP_001295307.1.51693 WP_001295307.1.51718 WP_001295307.1.51736 WP_001295307.1.51757 WP_001295307.1.51760 WP_001295307.1.51784 WP_001295307.1.518 WP_001295307.1.51804 WP_001295307.1.51834 WP_001295307.1.51837 WP_001295307.1.51839 WP_001295307.1.51869 WP_001295307.1.51873 WP_001295307.1.51881 WP_001295307.1.51896 WP_001295307.1.51899 WP_001295307.1.51906 WP_001295307.1.51944 WP_001295307.1.51949 WP_001295307.1.51968 WP_001295307.1.51979 WP_001295307.1.51985 WP_001295307.1.51988 WP_001295307.1.5199 WP_001295307.1.52002 WP_001295307.1.52011 WP_001295307.1.52020 WP_001295307.1.52039 WP_001295307.1.52044 WP_001295307.1.52048 WP_001295307.1.52062 WP_001295307.1.52076 WP_001295307.1.52085 WP_001295307.1.52098 WP_001295307.1.52111 WP_001295307.1.52126 WP_001295307.1.52127 WP_001295307.1.52135 WP_001295307.1.52137 WP_001295307.1.5217 WP_001295307.1.52171 WP_001295307.1.52186 WP_001295307.1.52200 WP_001295307.1.52213 WP_001295307.1.52214 WP_001295307.1.52225 WP_001295307.1.52230 WP_001295307.1.52236 WP_001295307.1.52240 WP_001295307.1.52243 WP_001295307.1.52249 WP_001295307.1.52257 WP_001295307.1.52258 WP_001295307.1.5227 WP_001295307.1.52270 WP_001295307.1.52271 WP_001295307.1.52272 WP_001295307.1.52299 WP_001295307.1.52304 WP_001295307.1.52313 WP_001295307.1.52324 WP_001295307.1.52328 WP_001295307.1.52333 WP_001295307.1.52363 WP_001295307.1.52378 WP_001295307.1.5239 WP_001295307.1.52399 WP_001295307.1.52406 WP_001295307.1.52413 WP_001295307.1.52419 WP_001295307.1.52421 WP_001295307.1.52492 WP_001295307.1.52496 WP_001295307.1.52524 WP_001295307.1.52543 WP_001295307.1.52544 WP_001295307.1.52554 WP_001295307.1.52558 WP_001295307.1.52567 WP_001295307.1.52568 WP_001295307.1.52601 WP_001295307.1.52612 WP_001295307.1.52631 WP_001295307.1.5265 WP_001295307.1.52662 WP_001295307.1.52691 WP_001295307.1.52710 WP_001295307.1.5272 WP_001295307.1.52735 WP_001295307.1.52755 WP_001295307.1.52762 WP_001295307.1.52771 WP_001295307.1.52774 WP_001295307.1.52777 WP_001295307.1.52780 WP_001295307.1.52781 WP_001295307.1.52844 WP_001295307.1.52846 WP_001295307.1.5285 WP_001295307.1.52852 WP_001295307.1.52853 WP_001295307.1.52855 WP_001295307.1.52881 WP_001295307.1.52883 WP_001295307.1.52895 WP_001295307.1.52908 WP_001295307.1.5291 WP_001295307.1.52913 WP_001295307.1.52933 WP_001295307.1.52942 WP_001295307.1.52945 WP_001295307.1.52962 WP_001295307.1.52995 WP_001295307.1.52996 WP_001295307.1.53012 WP_001295307.1.53020 WP_001295307.1.53021 WP_001295307.1.53065 WP_001295307.1.53084 WP_001295307.1.53095 WP_001295307.1.53099 WP_001295307.1.5310 WP_001295307.1.53110 WP_001295307.1.53123 WP_001295307.1.53155 WP_001295307.1.53162 WP_001295307.1.53181 WP_001295307.1.53186 WP_001295307.1.532 WP_001295307.1.53211 WP_001295307.1.5322 WP_001295307.1.53223 WP_001295307.1.53228 WP_001295307.1.53238 WP_001295307.1.53242 WP_001295307.1.53244 WP_001295307.1.53252 WP_001295307.1.53262 WP_001295307.1.53270 WP_001295307.1.53277 WP_001295307.1.53308 WP_001295307.1.53356 WP_001295307.1.53360 WP_001295307.1.53364 WP_001295307.1.53377 WP_001295307.1.53401 WP_001295307.1.53410 WP_001295307.1.53415 WP_001295307.1.53419 WP_001295307.1.5342 WP_001295307.1.53428 WP_001295307.1.53431 WP_001295307.1.53482 WP_001295307.1.53505 WP_001295307.1.5351 WP_001295307.1.53535 WP_001295307.1.53537 WP_001295307.1.53545 WP_001295307.1.53556 WP_001295307.1.53557 WP_001295307.1.53574 WP_001295307.1.53582 WP_001295307.1.53587 WP_001295307.1.53589 WP_001295307.1.53592 WP_001295307.1.53594 WP_001295307.1.5362 WP_001295307.1.53642 WP_001295307.1.53645 WP_001295307.1.53649 WP_001295307.1.53687 WP_001295307.1.53690 WP_001295307.1.53693 WP_001295307.1.53706 WP_001295307.1.53769 WP_001295307.1.53809 WP_001295307.1.53810 WP_001295307.1.53811 WP_001295307.1.53863 WP_001295307.1.53866 WP_001295307.1.53878 WP_001295307.1.53884 WP_001295307.1.5391 WP_001295307.1.5393 WP_001295307.1.53940 WP_001295307.1.5395 WP_001295307.1.53966 WP_001295307.1.53968 WP_001295307.1.53991 WP_001295307.1.53994 WP_001295307.1.54002 WP_001295307.1.54013 WP_001295307.1.54023 WP_001295307.1.54024 WP_001295307.1.54028 WP_001295307.1.54032 WP_001295307.1.54051 WP_001295307.1.54072 WP_001295307.1.54091 WP_001295307.1.54095 WP_001295307.1.54102 WP_001295307.1.54104 WP_001295307.1.54144 WP_001295307.1.54169 WP_001295307.1.54185 WP_001295307.1.54188 WP_001295307.1.54202 WP_001295307.1.54208 WP_001295307.1.54263 WP_001295307.1.54307 WP_001295307.1.54313 WP_001295307.1.54317 WP_001295307.1.54328 WP_001295307.1.54329 WP_001295307.1.5433 WP_001295307.1.5434 WP_001295307.1.54344 WP_001295307.1.54359 WP_001295307.1.54388 WP_001295307.1.54394 WP_001295307.1.5441 WP_001295307.1.54411 WP_001295307.1.54417 WP_001295307.1.54418 WP_001295307.1.54429 WP_001295307.1.54439 WP_001295307.1.54454 WP_001295307.1.54463 WP_001295307.1.54476 WP_001295307.1.54507 WP_001295307.1.54524 WP_001295307.1.54534 WP_001295307.1.54546 WP_001295307.1.54590 WP_001295307.1.54591 WP_001295307.1.5460 WP_001295307.1.54601 WP_001295307.1.54602 WP_001295307.1.54605 WP_001295307.1.5461 WP_001295307.1.54614 WP_001295307.1.54617 WP_001295307.1.54620 WP_001295307.1.54625 WP_001295307.1.54638 WP_001295307.1.54641 WP_001295307.1.54643 WP_001295307.1.5467 WP_001295307.1.54688 WP_001295307.1.54695 WP_001295307.1.5470 WP_001295307.1.54708 WP_001295307.1.54725 WP_001295307.1.54729 WP_001295307.1.54754 WP_001295307.1.54755 WP_001295307.1.54760 WP_001295307.1.54769 WP_001295307.1.5478 WP_001295307.1.5479 WP_001295307.1.54798 WP_001295307.1.54817 WP_001295307.1.54829 WP_001295307.1.5486 WP_001295307.1.54875 WP_001295307.1.54883 WP_001295307.1.54918 WP_001295307.1.54921 WP_001295307.1.54927 WP_001295307.1.54940 WP_001295307.1.54941 WP_001295307.1.54946 WP_001295307.1.54981 WP_001295307.1.54989 WP_001295307.1.54991 WP_001295307.1.54993 WP_001295307.1.55003 WP_001295307.1.55005 WP_001295307.1.55009 WP_001295307.1.55041 WP_001295307.1.55070 WP_001295307.1.55112 WP_001295307.1.55115 WP_001295307.1.55123 WP_001295307.1.55134 WP_001295307.1.55144 WP_001295307.1.55149 WP_001295307.1.55151 WP_001295307.1.55177 WP_001295307.1.55179 WP_001295307.1.55197 WP_001295307.1.5520 WP_001295307.1.55203 WP_001295307.1.55222 WP_001295307.1.55226 WP_001295307.1.55273 WP_001295307.1.55275 WP_001295307.1.55286 WP_001295307.1.55338 WP_001295307.1.55342 WP_001295307.1.55357 WP_001295307.1.55359 WP_001295307.1.55374 WP_001295307.1.55381 WP_001295307.1.55417 WP_001295307.1.55420 WP_001295307.1.55424 WP_001295307.1.55425 WP_001295307.1.5546 WP_001295307.1.55466 WP_001295307.1.55472 WP_001295307.1.55482 WP_001295307.1.55483 WP_001295307.1.55489 WP_001295307.1.55507 WP_001295307.1.55529 WP_001295307.1.55550 WP_001295307.1.55551 WP_001295307.1.55552 WP_001295307.1.55556 WP_001295307.1.55560 WP_001295307.1.55563 WP_001295307.1.55571 WP_001295307.1.55574 WP_001295307.1.55597 WP_001295307.1.55608 WP_001295307.1.5561 WP_001295307.1.5566 WP_001295307.1.55676 WP_001295307.1.55709 WP_001295307.1.55720 WP_001295307.1.55727 WP_001295307.1.55730 WP_001295307.1.55731 WP_001295307.1.55744 WP_001295307.1.55757 WP_001295307.1.55787 WP_001295307.1.55790 WP_001295307.1.55791 WP_001295307.1.55808 WP_001295307.1.55820 WP_001295307.1.55825 WP_001295307.1.55838 WP_001295307.1.55844 WP_001295307.1.55868 WP_001295307.1.55888 WP_001295307.1.55892 WP_001295307.1.55896 WP_001295307.1.55897 WP_001295307.1.55936 WP_001295307.1.55979 WP_001295307.1.55981 WP_001295307.1.55988 WP_001295307.1.55990 WP_001295307.1.56033 WP_001295307.1.56040 WP_001295307.1.56047 WP_001295307.1.56072 WP_001295307.1.561 WP_001295307.1.56101 WP_001295307.1.56122 WP_001295307.1.56139 WP_001295307.1.5614 WP_001295307.1.56149 WP_001295307.1.56151 WP_001295307.1.5616 WP_001295307.1.56164 WP_001295307.1.56169 WP_001295307.1.56177 WP_001295307.1.56193 WP_001295307.1.56197 WP_001295307.1.562 WP_001295307.1.56216 WP_001295307.1.56231 WP_001295307.1.56278 WP_001295307.1.56285 WP_001295307.1.56293 WP_001295307.1.56302 WP_001295307.1.5632 WP_001295307.1.56338 WP_001295307.1.56345 WP_001295307.1.56358 WP_001295307.1.56371 WP_001295307.1.56388 WP_001295307.1.5639 WP_001295307.1.56390 WP_001295307.1.56392 WP_001295307.1.56399 WP_001295307.1.56402 WP_001295307.1.56436 WP_001295307.1.56439 WP_001295307.1.56446 WP_001295307.1.56457 WP_001295307.1.5646 WP_001295307.1.56469 WP_001295307.1.56481 WP_001295307.1.56489 WP_001295307.1.5649 WP_001295307.1.56491 WP_001295307.1.56502 WP_001295307.1.56513 WP_001295307.1.56523 WP_001295307.1.56528 WP_001295307.1.56543 WP_001295307.1.56554 WP_001295307.1.56571 WP_001295307.1.56573 WP_001295307.1.56586 WP_001295307.1.56650 WP_001295307.1.56662 WP_001295307.1.56680 WP_001295307.1.56689 WP_001295307.1.5670 WP_001295307.1.56704 WP_001295307.1.56713 WP_001295307.1.56714 WP_001295307.1.56721 WP_001295307.1.56742 WP_001295307.1.56776 WP_001295307.1.56777 WP_001295307.1.56786 WP_001295307.1.56787 WP_001295307.1.56789 WP_001295307.1.56799 WP_001295307.1.56821 WP_001295307.1.56835 WP_001295307.1.56846 WP_001295307.1.5685 WP_001295307.1.56871 WP_001295307.1.56882 WP_001295307.1.56908 WP_001295307.1.56932 WP_001295307.1.56933 WP_001295307.1.56934 WP_001295307.1.56936 WP_001295307.1.56937 WP_001295307.1.56941 WP_001295307.1.56951 WP_001295307.1.56978 WP_001295307.1.56980 WP_001295307.1.56992 WP_001295307.1.57011 WP_001295307.1.57032 WP_001295307.1.57045 WP_001295307.1.57051 WP_001295307.1.57068 WP_001295307.1.57071 WP_001295307.1.57072 WP_001295307.1.57079 WP_001295307.1.57086 WP_001295307.1.57100 WP_001295307.1.57150 WP_001295307.1.57159 WP_001295307.1.57180 WP_001295307.1.57182 WP_001295307.1.57197 WP_001295307.1.57202 WP_001295307.1.57213 WP_001295307.1.57216 WP_001295307.1.57222 WP_001295307.1.57254 WP_001295307.1.57266 WP_001295307.1.57269 WP_001295307.1.57278 WP_001295307.1.57281 WP_001295307.1.57319 WP_001295307.1.57348 WP_001295307.1.57386 WP_001295307.1.57401 WP_001295307.1.57403 WP_001295307.1.57410 WP_001295307.1.57414 WP_001295307.1.5742 WP_001295307.1.57432 WP_001295307.1.57438 WP_001295307.1.57451 WP_001295307.1.57453 WP_001295307.1.57466 WP_001295307.1.5748 WP_001295307.1.57487 WP_001295307.1.57492 WP_001295307.1.57517 WP_001295307.1.57538 WP_001295307.1.57539 WP_001295307.1.5755 WP_001295307.1.57550 WP_001295307.1.57558 WP_001295307.1.57574 WP_001295307.1.57588 WP_001295307.1.57608 WP_001295307.1.57610 WP_001295307.1.57628 WP_001295307.1.57634 WP_001295307.1.57638 WP_001295307.1.5764 WP_001295307.1.57646 WP_001295307.1.57659 WP_001295307.1.57663 WP_001295307.1.57719 WP_001295307.1.57738 WP_001295307.1.57812 WP_001295307.1.57832 WP_001295307.1.57836 WP_001295307.1.57846 WP_001295307.1.57854 WP_001295307.1.5786 WP_001295307.1.5787 WP_001295307.1.57898 WP_001295307.1.57903 WP_001295307.1.57904 WP_001295307.1.57920 WP_001295307.1.57951 WP_001295307.1.57975 WP_001295307.1.57982 WP_001295307.1.57983 WP_001295307.1.57994 WP_001295307.1.58001 WP_001295307.1.58009 WP_001295307.1.58022 WP_001295307.1.58038 WP_001295307.1.58045 WP_001295307.1.58048 WP_001295307.1.58057 WP_001295307.1.58060 WP_001295307.1.58080 WP_001295307.1.58092 WP_001295307.1.58094 WP_001295307.1.58097 WP_001295307.1.58098 WP_001295307.1.5810 WP_001295307.1.58107 WP_001295307.1.5812 WP_001295307.1.58128 WP_001295307.1.58143 WP_001295307.1.58146 WP_001295307.1.58163 WP_001295307.1.58169 WP_001295307.1.58172 WP_001295307.1.58206 WP_001295307.1.58226 WP_001295307.1.58233 WP_001295307.1.58238 WP_001295307.1.58244 WP_001295307.1.58248 WP_001295307.1.58267 WP_001295307.1.58289 WP_001295307.1.58292 WP_001295307.1.58316 WP_001295307.1.58336 WP_001295307.1.58340 WP_001295307.1.58345 WP_001295307.1.58368 WP_001295307.1.58371 WP_001295307.1.58384 WP_001295307.1.584 WP_001295307.1.58401 WP_001295307.1.58408 WP_001295307.1.5842 WP_001295307.1.58420 WP_001295307.1.58423 WP_001295307.1.58424 WP_001295307.1.58429 WP_001295307.1.58440 WP_001295307.1.58444 WP_001295307.1.58445 WP_001295307.1.58449 WP_001295307.1.58459 WP_001295307.1.58475 WP_001295307.1.58484 WP_001295307.1.58493 WP_001295307.1.58496 WP_001295307.1.58507 WP_001295307.1.58514 WP_001295307.1.5852 WP_001295307.1.58528 WP_001295307.1.58547 WP_001295307.1.58552 WP_001295307.1.58560 WP_001295307.1.58572 WP_001295307.1.58582 WP_001295307.1.58609 WP_001295307.1.58617 WP_001295307.1.58622 WP_001295307.1.58657 WP_001295307.1.58680 WP_001295307.1.58692 WP_001295307.1.58705 WP_001295307.1.58707 WP_001295307.1.58723 WP_001295307.1.58737 WP_001295307.1.58799 WP_001295307.1.58837 WP_001295307.1.58867 WP_001295307.1.58870 WP_001295307.1.58901 WP_001295307.1.58940 WP_001295307.1.58942 WP_001295307.1.58951 WP_001295307.1.58958 WP_001295307.1.58976 WP_001295307.1.58983 WP_001295307.1.58999 WP_001295307.1.59024 WP_001295307.1.59026 WP_001295307.1.59035 WP_001295307.1.59038 WP_001295307.1.59047 WP_001295307.1.5906 WP_001295307.1.59060 WP_001295307.1.59073 WP_001295307.1.59083 WP_001295307.1.59119 WP_001295307.1.59165 WP_001295307.1.59174 WP_001295307.1.59190 WP_001295307.1.59199 WP_001295307.1.59218 WP_001295307.1.59226 WP_001295307.1.5927 WP_001295307.1.59280 WP_001295307.1.59291 WP_001295307.1.59292 WP_001295307.1.59302 WP_001295307.1.59306 WP_001295307.1.59359 WP_001295307.1.59374 WP_001295307.1.59395 WP_001295307.1.59396 WP_001295307.1.59407 WP_001295307.1.59409 WP_001295307.1.59413 WP_001295307.1.5942 WP_001295307.1.59423 WP_001295307.1.59425 WP_001295307.1.59426 WP_001295307.1.59434 WP_001295307.1.59470 WP_001295307.1.59483 WP_001295307.1.59491 WP_001295307.1.59513 WP_001295307.1.59533 WP_001295307.1.59553 WP_001295307.1.59572 WP_001295307.1.59577 WP_001295307.1.59579 WP_001295307.1.59590 WP_001295307.1.59611 WP_001295307.1.59613 WP_001295307.1.59615 WP_001295307.1.59621 WP_001295307.1.5963 WP_001295307.1.59638 WP_001295307.1.5965 WP_001295307.1.59660 WP_001295307.1.59679 WP_001295307.1.59689 WP_001295307.1.59699 WP_001295307.1.597 WP_001295307.1.59714 WP_001295307.1.59717 WP_001295307.1.59730 WP_001295307.1.59733 WP_001295307.1.59737 WP_001295307.1.59745 WP_001295307.1.59748 WP_001295307.1.59781 WP_001295307.1.59782 WP_001295307.1.59793 WP_001295307.1.59815 WP_001295307.1.59823 WP_001295307.1.59836 WP_001295307.1.59838 WP_001295307.1.59853 WP_001295307.1.59855 WP_001295307.1.59858 WP_001295307.1.59877 WP_001295307.1.59894 WP_001295307.1.5990 WP_001295307.1.59900 WP_001295307.1.59905 WP_001295307.1.59912 WP_001295307.1.59914 WP_001295307.1.59931 WP_001295307.1.59932 WP_001295307.1.59959 WP_001295307.1.59970 WP_001295307.1.59980 WP_001295307.1.59981 WP_001295307.1.59989 WP_001295307.1.60005 WP_001295307.1.60023 WP_001295307.1.60031 WP_001295307.1.60042 WP_001295307.1.60043 WP_001295307.1.60048 WP_001295307.1.60067 WP_001295307.1.60070 WP_001295307.1.60095 WP_001295307.1.60096 WP_001295307.1.60110 WP_001295307.1.60117 WP_001295307.1.6013 WP_001295307.1.60133 WP_001295307.1.60151 WP_001295307.1.60186 WP_001295307.1.6022 WP_001295307.1.60225 WP_001295307.1.60228 WP_001295307.1.60235 WP_001295307.1.60246 WP_001295307.1.60304 WP_001295307.1.60325 WP_001295307.1.60337 WP_001295307.1.60342 WP_001295307.1.60343 WP_001295307.1.60350 WP_001295307.1.60373 WP_001295307.1.60374 WP_001295307.1.60387 WP_001295307.1.60411 WP_001295307.1.60436 WP_001295307.1.60443 WP_001295307.1.60457 WP_001295307.1.60461 WP_001295307.1.60477 WP_001295307.1.60491 WP_001295307.1.60498 WP_001295307.1.60505 WP_001295307.1.60544 WP_001295307.1.60550 WP_001295307.1.60555 WP_001295307.1.60559 WP_001295307.1.60567 WP_001295307.1.60570 WP_001295307.1.60576 WP_001295307.1.6059 WP_001295307.1.60591 WP_001295307.1.60606 WP_001295307.1.6061 WP_001295307.1.60613 WP_001295307.1.60614 WP_001295307.1.60630 WP_001295307.1.6064 WP_001295307.1.60644 WP_001295307.1.60647 WP_001295307.1.60654 WP_001295307.1.6066 WP_001295307.1.60671 WP_001295307.1.6068 WP_001295307.1.60684 WP_001295307.1.60698 WP_001295307.1.60717 WP_001295307.1.60744 WP_001295307.1.60761 WP_001295307.1.60764 WP_001295307.1.60816 WP_001295307.1.60826 WP_001295307.1.60832 WP_001295307.1.60835 WP_001295307.1.60847 WP_001295307.1.60872 WP_001295307.1.60895 WP_001295307.1.60901 WP_001295307.1.60921 WP_001295307.1.60925 WP_001295307.1.60927 WP_001295307.1.6094 WP_001295307.1.60974 WP_001295307.1.61005 WP_001295307.1.61006 WP_001295307.1.61035 WP_001295307.1.61039 WP_001295307.1.61046 WP_001295307.1.61058 WP_001295307.1.6106 WP_001295307.1.61096 WP_001295307.1.61097 WP_001295307.1.61099 WP_001295307.1.6110 WP_001295307.1.61102 WP_001295307.1.61108 WP_001295307.1.61112 WP_001295307.1.61121 WP_001295307.1.61132 WP_001295307.1.61148 WP_001295307.1.61170 WP_001295307.1.61174 WP_001295307.1.61175 WP_001295307.1.61181 WP_001295307.1.61183 WP_001295307.1.61186 WP_001295307.1.61223 WP_001295307.1.61225 WP_001295307.1.61241 WP_001295307.1.61245 WP_001295307.1.61253 WP_001295307.1.61268 WP_001295307.1.61284 WP_001295307.1.61292 WP_001295307.1.613 WP_001295307.1.61360 WP_001295307.1.61362 WP_001295307.1.61364 WP_001295307.1.61373 WP_001295307.1.6138 WP_001295307.1.61398 WP_001295307.1.61442 WP_001295307.1.61445 WP_001295307.1.61480 WP_001295307.1.61496 WP_001295307.1.615 WP_001295307.1.61505 WP_001295307.1.61512 WP_001295307.1.61517 WP_001295307.1.61524 WP_001295307.1.61608 WP_001295307.1.61612 WP_001295307.1.61617 WP_001295307.1.61623 WP_001295307.1.61636 WP_001295307.1.61643 WP_001295307.1.61663 WP_001295307.1.61703 WP_001295307.1.61718 WP_001295307.1.61739 WP_001295307.1.61758 WP_001295307.1.61770 WP_001295307.1.61772 WP_001295307.1.61779 WP_001295307.1.61789 WP_001295307.1.618 WP_001295307.1.61806 WP_001295307.1.61822 WP_001295307.1.61835 WP_001295307.1.61853 WP_001295307.1.61858 WP_001295307.1.61874 WP_001295307.1.61893 WP_001295307.1.61939 WP_001295307.1.61949 WP_001295307.1.61957 WP_001295307.1.61966 WP_001295307.1.62038 WP_001295307.1.62041 WP_001295307.1.62043 WP_001295307.1.62091 WP_001295307.1.62099 WP_001295307.1.62102 WP_001295307.1.6212 WP_001295307.1.62135 WP_001295307.1.62157 WP_001295307.1.62182 WP_001295307.1.62236 WP_001295307.1.62262 WP_001295307.1.62264 WP_001295307.1.62273 WP_001295307.1.62290 WP_001295307.1.62296 WP_001295307.1.62303 WP_001295307.1.62322 WP_001295307.1.62348 WP_001295307.1.62358 WP_001295307.1.62424 WP_001295307.1.62447 WP_001295307.1.6245 WP_001295307.1.62454 WP_001295307.1.62460 WP_001295307.1.62480 WP_001295307.1.62481 WP_001295307.1.62503 WP_001295307.1.62507 WP_001295307.1.62513 WP_001295307.1.62514 WP_001295307.1.62529 WP_001295307.1.62541 WP_001295307.1.62555 WP_001295307.1.62586 WP_001295307.1.6261 WP_001295307.1.62612 WP_001295307.1.62631 WP_001295307.1.62642 WP_001295307.1.62646 WP_001295307.1.62668 WP_001295307.1.62675 WP_001295307.1.62681 WP_001295307.1.62714 WP_001295307.1.62735 WP_001295307.1.62750 WP_001295307.1.62762 WP_001295307.1.62769 WP_001295307.1.62780 WP_001295307.1.62784 WP_001295307.1.62787 WP_001295307.1.62788 WP_001295307.1.62802 WP_001295307.1.62812 WP_001295307.1.62818 WP_001295307.1.62819 WP_001295307.1.6282 WP_001295307.1.62840 WP_001295307.1.62843 WP_001295307.1.62850 WP_001295307.1.62851 WP_001295307.1.62866 WP_001295307.1.62885 WP_001295307.1.62888 WP_001295307.1.62919 WP_001295307.1.6293 WP_001295307.1.62951 WP_001295307.1.62959 WP_001295307.1.62973 WP_001295307.1.62989 WP_001295307.1.6299 WP_001295307.1.62992 WP_001295307.1.63023 WP_001295307.1.6307 WP_001295307.1.63078 WP_001295307.1.63113 WP_001295307.1.63167 WP_001295307.1.63177 WP_001295307.1.63189 WP_001295307.1.6323 WP_001295307.1.63246 WP_001295307.1.63271 WP_001295307.1.63285 WP_001295307.1.63287 WP_001295307.1.63305 WP_001295307.1.6331 WP_001295307.1.63310 WP_001295307.1.63330 WP_001295307.1.6334 WP_001295307.1.63350 WP_001295307.1.63370 WP_001295307.1.63374 WP_001295307.1.63393 WP_001295307.1.63419 WP_001295307.1.63433 WP_001295307.1.63435 WP_001295307.1.63437 WP_001295307.1.63445 WP_001295307.1.63453 WP_001295307.1.63465 WP_001295307.1.63466 WP_001295307.1.63467 WP_001295307.1.63470 WP_001295307.1.63478 WP_001295307.1.6348 WP_001295307.1.63484 WP_001295307.1.63491 WP_001295307.1.63496 WP_001295307.1.63536 WP_001295307.1.63554 WP_001295307.1.63556 WP_001295307.1.63563 WP_001295307.1.63576 WP_001295307.1.63586 WP_001295307.1.63602 WP_001295307.1.63604 WP_001295307.1.63608 WP_001295307.1.63612 WP_001295307.1.63615 WP_001295307.1.6364 WP_001295307.1.63666 WP_001295307.1.63679 WP_001295307.1.63683 WP_001295307.1.63703 WP_001295307.1.63721 WP_001295307.1.63746 WP_001295307.1.63800 WP_001295307.1.63810 WP_001295307.1.63814 WP_001295307.1.63821 WP_001295307.1.63856 WP_001295307.1.63871 WP_001295307.1.63872 WP_001295307.1.63944 WP_001295307.1.63957 WP_001295307.1.63964 WP_001295307.1.63969 WP_001295307.1.63990 WP_001295307.1.64008 WP_001295307.1.64014 WP_001295307.1.64030 WP_001295307.1.64040 WP_001295307.1.64045 WP_001295307.1.64050 WP_001295307.1.64053 WP_001295307.1.64074 WP_001295307.1.64080 WP_001295307.1.64086 WP_001295307.1.64110 WP_001295307.1.64138 WP_001295307.1.64150 WP_001295307.1.64153 WP_001295307.1.6416 WP_001295307.1.64161 WP_001295307.1.64165 WP_001295307.1.64175 WP_001295307.1.64180 WP_001295307.1.64190 WP_001295307.1.64193 WP_001295307.1.64280 WP_001295307.1.64285 WP_001295307.1.64286 WP_001295307.1.643 WP_001295307.1.6431 WP_001295307.1.64312 WP_001295307.1.64321 WP_001295307.1.64330 WP_001295307.1.64337 WP_001295307.1.64353 WP_001295307.1.64355 WP_001295307.1.64356 WP_001295307.1.64371 WP_001295307.1.64380 WP_001295307.1.64391 WP_001295307.1.6441 WP_001295307.1.64417 WP_001295307.1.64437 WP_001295307.1.64438 WP_001295307.1.6444 WP_001295307.1.64448 WP_001295307.1.6445 WP_001295307.1.64458 WP_001295307.1.6446 WP_001295307.1.64519 WP_001295307.1.64520 WP_001295307.1.64540 WP_001295307.1.64547 WP_001295307.1.64563 WP_001295307.1.64634 WP_001295307.1.64657 WP_001295307.1.64670 WP_001295307.1.6469 WP_001295307.1.64693 WP_001295307.1.647 WP_001295307.1.64707 WP_001295307.1.64712 WP_001295307.1.64746 WP_001295307.1.64749 WP_001295307.1.64784 WP_001295307.1.64789 WP_001295307.1.64793 WP_001295307.1.64821 WP_001295307.1.64840 WP_001295307.1.64866 WP_001295307.1.64875 WP_001295307.1.64895 WP_001295307.1.64901 WP_001295307.1.64912 WP_001295307.1.64926 WP_001295307.1.64930 WP_001295307.1.64939 WP_001295307.1.64946 WP_001295307.1.64970 WP_001295307.1.6499 WP_001295307.1.64990 WP_001295307.1.6500 WP_001295307.1.65023 WP_001295307.1.65035 WP_001295307.1.65040 WP_001295307.1.65061 WP_001295307.1.65084 WP_001295307.1.65097 WP_001295307.1.651 WP_001295307.1.65104 WP_001295307.1.6511 WP_001295307.1.65110 WP_001295307.1.65114 WP_001295307.1.65116 WP_001295307.1.65118 WP_001295307.1.65122 WP_001295307.1.65135 WP_001295307.1.65155 WP_001295307.1.6516 WP_001295307.1.65179 WP_001295307.1.65192 WP_001295307.1.65206 WP_001295307.1.65240 WP_001295307.1.65256 WP_001295307.1.6527 WP_001295307.1.65271 WP_001295307.1.65286 WP_001295307.1.65296 WP_001295307.1.65305 WP_001295307.1.65306 WP_001295307.1.65353 WP_001295307.1.65355 WP_001295307.1.65364 WP_001295307.1.6537 WP_001295307.1.65370 WP_001295307.1.65372 WP_001295307.1.654 WP_001295307.1.65405 WP_001295307.1.65408 WP_001295307.1.65413 WP_001295307.1.65415 WP_001295307.1.65456 WP_001295307.1.65484 WP_001295307.1.65493 WP_001295307.1.6553 WP_001295307.1.65531 WP_001295307.1.65546 WP_001295307.1.65565 WP_001295307.1.65571 WP_001295307.1.65581 WP_001295307.1.65596 WP_001295307.1.65606 WP_001295307.1.6563 WP_001295307.1.65662 WP_001295307.1.65667 WP_001295307.1.65672 WP_001295307.1.65677 WP_001295307.1.65708 WP_001295307.1.65714 WP_001295307.1.65749 WP_001295307.1.6576 WP_001295307.1.65762 WP_001295307.1.65834 WP_001295307.1.6587 WP_001295307.1.65875 WP_001295307.1.65898 WP_001295307.1.65912 WP_001295307.1.65954 WP_001295307.1.65957 WP_001295307.1.65961 WP_001295307.1.65962 WP_001295307.1.65963 WP_001295307.1.65976 WP_001295307.1.65978 WP_001295307.1.65988 WP_001295307.1.6599 WP_001295307.1.65991 WP_001295307.1.66001 WP_001295307.1.66016 WP_001295307.1.66017 WP_001295307.1.66022 WP_001295307.1.66033 WP_001295307.1.6604 WP_001295307.1.66044 WP_001295307.1.66050 WP_001295307.1.66059 WP_001295307.1.66071 WP_001295307.1.66094 WP_001295307.1.66100 WP_001295307.1.66102 WP_001295307.1.66104 WP_001295307.1.66105 WP_001295307.1.66121 WP_001295307.1.66127 WP_001295307.1.66161 WP_001295307.1.6618 WP_001295307.1.66181 WP_001295307.1.66197 WP_001295307.1.6622 WP_001295307.1.66255 WP_001295307.1.66264 WP_001295307.1.66280 WP_001295307.1.66288 WP_001295307.1.66290 WP_001295307.1.66295 WP_001295307.1.66327 WP_001295307.1.66335 WP_001295307.1.6635 WP_001295307.1.66376 WP_001295307.1.66387 WP_001295307.1.66389 WP_001295307.1.66395 WP_001295307.1.66412 WP_001295307.1.66421 WP_001295307.1.66432 WP_001295307.1.66448 WP_001295307.1.66501 WP_001295307.1.66511 WP_001295307.1.66523 WP_001295307.1.66531 WP_001295307.1.66550 WP_001295307.1.66559 WP_001295307.1.66566 WP_001295307.1.66579 WP_001295307.1.66624 WP_001295307.1.66644 WP_001295307.1.6665 WP_001295307.1.6666 WP_001295307.1.66667 WP_001295307.1.66668 WP_001295307.1.66700 WP_001295307.1.66706 WP_001295307.1.66708 WP_001295307.1.66719 WP_001295307.1.66727 WP_001295307.1.66751 WP_001295307.1.66758 WP_001295307.1.6676 WP_001295307.1.66783 WP_001295307.1.66791 WP_001295307.1.66794 WP_001295307.1.66795 WP_001295307.1.66796 WP_001295307.1.66849 WP_001295307.1.66873 WP_001295307.1.66922 WP_001295307.1.66926 WP_001295307.1.66948 WP_001295307.1.66975 WP_001295307.1.66978 WP_001295307.1.6698 WP_001295307.1.66984 WP_001295307.1.6701 WP_001295307.1.67018 WP_001295307.1.67021 WP_001295307.1.67022 WP_001295307.1.67026 WP_001295307.1.67029 WP_001295307.1.67035 WP_001295307.1.67047 WP_001295307.1.67055 WP_001295307.1.6706 WP_001295307.1.67073 WP_001295307.1.67102 WP_001295307.1.67132 WP_001295307.1.67137 WP_001295307.1.67149 WP_001295307.1.67153 WP_001295307.1.67158 WP_001295307.1.67164 WP_001295307.1.67174 WP_001295307.1.67193 WP_001295307.1.67194 WP_001295307.1.67200 WP_001295307.1.67209 WP_001295307.1.67210 WP_001295307.1.67214 WP_001295307.1.6723 WP_001295307.1.67258 WP_001295307.1.67272 WP_001295307.1.67284 WP_001295307.1.67293 WP_001295307.1.6735 WP_001295307.1.67373 WP_001295307.1.67383 WP_001295307.1.67412 WP_001295307.1.67415 WP_001295307.1.67427 WP_001295307.1.67446 WP_001295307.1.67451 WP_001295307.1.67452 WP_001295307.1.67454 WP_001295307.1.67456 WP_001295307.1.67462 WP_001295307.1.67464 WP_001295307.1.67467 WP_001295307.1.67468 WP_001295307.1.67495 WP_001295307.1.67522 WP_001295307.1.67533 WP_001295307.1.67538 WP_001295307.1.67549 WP_001295307.1.67553 WP_001295307.1.67581 WP_001295307.1.67590 WP_001295307.1.67606 WP_001295307.1.67660 WP_001295307.1.67663 WP_001295307.1.67669 WP_001295307.1.67676 WP_001295307.1.67681 WP_001295307.1.67685 WP_001295307.1.6769 WP_001295307.1.67690 WP_001295307.1.67701 WP_001295307.1.67704 WP_001295307.1.67724 WP_001295307.1.67726 WP_001295307.1.67732 WP_001295307.1.67737 WP_001295307.1.67758 WP_001295307.1.67760 WP_001295307.1.67775 WP_001295307.1.67780 WP_001295307.1.67786 WP_001295307.1.67787 WP_001295307.1.67788 WP_001295307.1.678 WP_001295307.1.67810 WP_001295307.1.67841 WP_001295307.1.67853 WP_001295307.1.67861 WP_001295307.1.67891 WP_001295307.1.67894 WP_001295307.1.67901 WP_001295307.1.6793 WP_001295307.1.67938 WP_001295307.1.67975 WP_001295307.1.67984 WP_001295307.1.67990 WP_001295307.1.67999 WP_001295307.1.68008 WP_001295307.1.68011 WP_001295307.1.68012 WP_001295307.1.6802 WP_001295307.1.68025 WP_001295307.1.6803 WP_001295307.1.68039 WP_001295307.1.68052 WP_001295307.1.68053 WP_001295307.1.68058 WP_001295307.1.68059 WP_001295307.1.68063 WP_001295307.1.68069 WP_001295307.1.68070 WP_001295307.1.68071 WP_001295307.1.68079 WP_001295307.1.68096 WP_001295307.1.6810 WP_001295307.1.68108 WP_001295307.1.68126 WP_001295307.1.68138 WP_001295307.1.6814 WP_001295307.1.68145 WP_001295307.1.68157 WP_001295307.1.68170 WP_001295307.1.68175 WP_001295307.1.68177 WP_001295307.1.682 WP_001295307.1.68200 WP_001295307.1.68215 WP_001295307.1.68231 WP_001295307.1.68241 WP_001295307.1.68255 WP_001295307.1.68278 WP_001295307.1.68279 WP_001295307.1.68281 WP_001295307.1.68283 WP_001295307.1.68292 WP_001295307.1.68300 WP_001295307.1.68336 WP_001295307.1.68341 WP_001295307.1.68347 WP_001295307.1.68362 WP_001295307.1.68369 WP_001295307.1.68372 WP_001295307.1.68395 WP_001295307.1.68396 WP_001295307.1.68411 WP_001295307.1.68441 WP_001295307.1.68442 WP_001295307.1.68482 WP_001295307.1.68490 WP_001295307.1.68493 WP_001295307.1.68523 WP_001295307.1.68524 WP_001295307.1.68534 WP_001295307.1.68566 WP_001295307.1.68572 WP_001295307.1.68584 WP_001295307.1.6859 WP_001295307.1.68598 WP_001295307.1.6860 WP_001295307.1.68609 WP_001295307.1.68630 WP_001295307.1.68632 WP_001295307.1.68635 WP_001295307.1.68673 WP_001295307.1.68678 WP_001295307.1.68679 WP_001295307.1.68695 WP_001295307.1.68697 WP_001295307.1.68701 WP_001295307.1.68711 WP_001295307.1.68735 WP_001295307.1.68750 WP_001295307.1.68751 WP_001295307.1.68752 WP_001295307.1.6877 WP_001295307.1.68793 WP_001295307.1.68795 WP_001295307.1.68797 WP_001295307.1.6880 WP_001295307.1.68801 WP_001295307.1.68838 WP_001295307.1.68847 WP_001295307.1.68865 WP_001295307.1.6887 WP_001295307.1.68873 WP_001295307.1.68877 WP_001295307.1.68880 WP_001295307.1.68911 WP_001295307.1.68915 WP_001295307.1.68924 WP_001295307.1.68936 WP_001295307.1.68942 WP_001295307.1.68952 WP_001295307.1.68956 WP_001295307.1.68961 WP_001295307.1.6897 WP_001295307.1.68995 WP_001295307.1.69033 WP_001295307.1.69039 WP_001295307.1.69054 WP_001295307.1.69127 WP_001295307.1.69144 WP_001295307.1.6916 WP_001295307.1.69160 WP_001295307.1.6919 WP_001295307.1.69192 WP_001295307.1.6921 WP_001295307.1.69221 WP_001295307.1.6923 WP_001295307.1.69258 WP_001295307.1.69261 WP_001295307.1.6929 WP_001295307.1.69303 WP_001295307.1.69305 WP_001295307.1.69327 WP_001295307.1.69341 WP_001295307.1.69350 WP_001295307.1.69351 WP_001295307.1.69382 WP_001295307.1.69390 WP_001295307.1.694 WP_001295307.1.69404 WP_001295307.1.69438 WP_001295307.1.69441 WP_001295307.1.6945 WP_001295307.1.69450 WP_001295307.1.69472 WP_001295307.1.69473 WP_001295307.1.69502 WP_001295307.1.69506 WP_001295307.1.69537 WP_001295307.1.69551 WP_001295307.1.69569 WP_001295307.1.69583 WP_001295307.1.69589 WP_001295307.1.69593 WP_001295307.1.69596 WP_001295307.1.69605 WP_001295307.1.69643 WP_001295307.1.69646 WP_001295307.1.69649 WP_001295307.1.69655 WP_001295307.1.69689 WP_001295307.1.697 WP_001295307.1.69716 WP_001295307.1.69730 WP_001295307.1.69735 WP_001295307.1.69780 WP_001295307.1.69786 WP_001295307.1.69803 WP_001295307.1.69810 WP_001295307.1.69818 WP_001295307.1.69831 WP_001295307.1.69832 WP_001295307.1.69868 WP_001295307.1.69872 WP_001295307.1.69887 WP_001295307.1.69896 WP_001295307.1.6993 WP_001295307.1.69963 WP_001295307.1.69972 WP_001295307.1.69979 WP_001295307.1.69999 WP_001295307.1.7001 WP_001295307.1.70041 WP_001295307.1.70063 WP_001295307.1.70081 WP_001295307.1.701 WP_001295307.1.70123 WP_001295307.1.70125 WP_001295307.1.7013 WP_001295307.1.70149 WP_001295307.1.7015 WP_001295307.1.70190 WP_001295307.1.70191 WP_001295307.1.70200 WP_001295307.1.70213 WP_001295307.1.70230 WP_001295307.1.70251 WP_001295307.1.70256 WP_001295307.1.70300 WP_001295307.1.70337 WP_001295307.1.70341 WP_001295307.1.70357 WP_001295307.1.70370 WP_001295307.1.70386 WP_001295307.1.70408 WP_001295307.1.70414 WP_001295307.1.70477 WP_001295307.1.70492 WP_001295307.1.7050 WP_001295307.1.70509 WP_001295307.1.7052 WP_001295307.1.70530 WP_001295307.1.70539 WP_001295307.1.70576 WP_001295307.1.70578 WP_001295307.1.70582 WP_001295307.1.70592 WP_001295307.1.70597 WP_001295307.1.70600 WP_001295307.1.70619 WP_001295307.1.70655 WP_001295307.1.70656 WP_001295307.1.70686 WP_001295307.1.70694 WP_001295307.1.70698 WP_001295307.1.70705 WP_001295307.1.70713 WP_001295307.1.70723 WP_001295307.1.70728 WP_001295307.1.70745 WP_001295307.1.70747 WP_001295307.1.70767 WP_001295307.1.70787 WP_001295307.1.70794 WP_001295307.1.70801 WP_001295307.1.70803 WP_001295307.1.70880 WP_001295307.1.7090 WP_001295307.1.70900 WP_001295307.1.70952 WP_001295307.1.70967 WP_001295307.1.71003 WP_001295307.1.7102 WP_001295307.1.71024 WP_001295307.1.71037 WP_001295307.1.71042 WP_001295307.1.71062 WP_001295307.1.71099 WP_001295307.1.71109 WP_001295307.1.71113 WP_001295307.1.71134 WP_001295307.1.71139 WP_001295307.1.71144 WP_001295307.1.71147 WP_001295307.1.71158 WP_001295307.1.71159 WP_001295307.1.71162 WP_001295307.1.71170 WP_001295307.1.71176 WP_001295307.1.71183 WP_001295307.1.71192 WP_001295307.1.71199 WP_001295307.1.71205 WP_001295307.1.7121 WP_001295307.1.71221 WP_001295307.1.71223 WP_001295307.1.71225 WP_001295307.1.71226 WP_001295307.1.71229 WP_001295307.1.71264 WP_001295307.1.71269 WP_001295307.1.71272 WP_001295307.1.71273 WP_001295307.1.71275 WP_001295307.1.71285 WP_001295307.1.71287 WP_001295307.1.71294 WP_001295307.1.71311 WP_001295307.1.71312 WP_001295307.1.71315 WP_001295307.1.71323 WP_001295307.1.71327 WP_001295307.1.71339 WP_001295307.1.71354 WP_001295307.1.71397 WP_001295307.1.71403 WP_001295307.1.71405 WP_001295307.1.71409 WP_001295307.1.71421 WP_001295307.1.71423 WP_001295307.1.71448 WP_001295307.1.7147 WP_001295307.1.71480 WP_001295307.1.71522 WP_001295307.1.71537 WP_001295307.1.71538 WP_001295307.1.71540 WP_001295307.1.71560 WP_001295307.1.71562 WP_001295307.1.71563 WP_001295307.1.71603 WP_001295307.1.71607 WP_001295307.1.71632 WP_001295307.1.71680 WP_001295307.1.71690 WP_001295307.1.71695 WP_001295307.1.71712 WP_001295307.1.71724 WP_001295307.1.71732 WP_001295307.1.71757 WP_001295307.1.71783 WP_001295307.1.71830 WP_001295307.1.71832 WP_001295307.1.71837 WP_001295307.1.71840 WP_001295307.1.71855 WP_001295307.1.71856 WP_001295307.1.71874 WP_001295307.1.71912 WP_001295307.1.7192 WP_001295307.1.71922 WP_001295307.1.71938 WP_001295307.1.71939 WP_001295307.1.71940 WP_001295307.1.71944 WP_001295307.1.71945 WP_001295307.1.71967 WP_001295307.1.71972 WP_001295307.1.71975 WP_001295307.1.71987 WP_001295307.1.71993 WP_001295307.1.71995 WP_001295307.1.72013 WP_001295307.1.72016 WP_001295307.1.72021 WP_001295307.1.72028 WP_001295307.1.72033 WP_001295307.1.72048 WP_001295307.1.7205 WP_001295307.1.72053 WP_001295307.1.72054 WP_001295307.1.72066 WP_001295307.1.72090 WP_001295307.1.72098 WP_001295307.1.7210 WP_001295307.1.72117 WP_001295307.1.72120 WP_001295307.1.72125 WP_001295307.1.72126 WP_001295307.1.72141 WP_001295307.1.72153 WP_001295307.1.72155 WP_001295307.1.72157 WP_001295307.1.72161 WP_001295307.1.72162 WP_001295307.1.72180 WP_001295307.1.72184 WP_001295307.1.72186 WP_001295307.1.72208 WP_001295307.1.72212 WP_001295307.1.72237 WP_001295307.1.72240 WP_001295307.1.72248 WP_001295307.1.7225 WP_001295307.1.72258 WP_001295307.1.72261 WP_001295307.1.72262 WP_001295307.1.72270 WP_001295307.1.72279 WP_001295307.1.72290 WP_001295307.1.72293 WP_001295307.1.72298 WP_001295307.1.723 WP_001295307.1.72316 WP_001295307.1.72322 WP_001295307.1.72337 WP_001295307.1.72342 WP_001295307.1.72352 WP_001295307.1.72359 WP_001295307.1.72362 WP_001295307.1.72388 WP_001295307.1.72391 WP_001295307.1.72392 WP_001295307.1.72397 WP_001295307.1.72414 WP_001295307.1.72425 WP_001295307.1.72427 WP_001295307.1.72431 WP_001295307.1.72436 WP_001295307.1.72449 WP_001295307.1.72469 WP_001295307.1.72485 WP_001295307.1.72493 WP_001295307.1.72507 WP_001295307.1.72511 WP_001295307.1.72521 WP_001295307.1.72522 WP_001295307.1.72535 WP_001295307.1.72537 WP_001295307.1.72544 WP_001295307.1.72551 WP_001295307.1.72574 WP_001295307.1.72582 WP_001295307.1.72588 WP_001295307.1.72593 WP_001295307.1.72596 WP_001295307.1.72599 WP_001295307.1.72606 WP_001295307.1.72608 WP_001295307.1.72614 WP_001295307.1.72615 WP_001295307.1.72616 WP_001295307.1.72641 WP_001295307.1.72643 WP_001295307.1.72651 WP_001295307.1.72652 WP_001295307.1.72663 WP_001295307.1.72694 WP_001295307.1.72695 WP_001295307.1.72698 WP_001295307.1.72700 WP_001295307.1.72706 WP_001295307.1.72725 WP_001295307.1.72729 WP_001295307.1.72738 WP_001295307.1.72745 WP_001295307.1.72747 WP_001295307.1.72748 WP_001295307.1.72751 WP_001295307.1.72758 WP_001295307.1.72764 WP_001295307.1.7277 WP_001295307.1.72778 WP_001295307.1.72804 WP_001295307.1.72806 WP_001295307.1.7281 WP_001295307.1.72857 WP_001295307.1.72858 WP_001295307.1.72860 WP_001295307.1.72869 WP_001295307.1.72893 WP_001295307.1.7291 WP_001295307.1.72910 WP_001295307.1.72913 WP_001295307.1.72947 WP_001295307.1.72950 WP_001295307.1.72956 WP_001295307.1.72962 WP_001295307.1.73000 WP_001295307.1.73010 WP_001295307.1.73015 WP_001295307.1.73032 WP_001295307.1.73039 WP_001295307.1.73061 WP_001295307.1.7307 WP_001295307.1.73072 WP_001295307.1.73075 WP_001295307.1.73085 WP_001295307.1.7309 WP_001295307.1.73094 WP_001295307.1.73126 WP_001295307.1.73129 WP_001295307.1.73193 WP_001295307.1.73197 WP_001295307.1.73215 WP_001295307.1.73230 WP_001295307.1.73243 WP_001295307.1.73249 WP_001295307.1.73251 WP_001295307.1.73257 WP_001295307.1.73259 WP_001295307.1.73277 WP_001295307.1.73278 WP_001295307.1.73283 WP_001295307.1.73291 WP_001295307.1.73292 WP_001295307.1.73295 WP_001295307.1.73333 WP_001295307.1.73340 WP_001295307.1.73343 WP_001295307.1.73344 WP_001295307.1.73349 WP_001295307.1.73385 WP_001295307.1.73393 WP_001295307.1.73428 WP_001295307.1.7345 WP_001295307.1.73468 WP_001295307.1.73486 WP_001295307.1.7349 WP_001295307.1.73498 WP_001295307.1.73524 WP_001295307.1.73565 WP_001295307.1.73572 WP_001295307.1.73592 WP_001295307.1.73604 WP_001295307.1.73626 WP_001295307.1.73631 WP_001295307.1.73652 WP_001295307.1.73663 WP_001295307.1.73700 WP_001295307.1.73717 WP_001295307.1.73743 WP_001295307.1.73748 WP_001295307.1.7376 WP_001295307.1.73783 WP_001295307.1.73785 WP_001295307.1.73797 WP_001295307.1.73801 WP_001295307.1.73807 WP_001295307.1.73811 WP_001295307.1.73827 WP_001295307.1.73835 WP_001295307.1.73843 WP_001295307.1.73844 WP_001295307.1.73846 WP_001295307.1.73859 WP_001295307.1.73882 WP_001295307.1.73897 WP_001295307.1.73908 WP_001295307.1.7392 WP_001295307.1.73942 WP_001295307.1.73968 WP_001295307.1.73980 WP_001295307.1.73992 WP_001295307.1.73995 WP_001295307.1.73996 WP_001295307.1.74032 WP_001295307.1.74041 WP_001295307.1.74045 WP_001295307.1.74046 WP_001295307.1.74051 WP_001295307.1.74053 WP_001295307.1.7407 WP_001295307.1.7411 WP_001295307.1.74123 WP_001295307.1.7413 WP_001295307.1.74156 WP_001295307.1.74184 WP_001295307.1.74185 WP_001295307.1.74213 WP_001295307.1.74223 WP_001295307.1.7424 WP_001295307.1.74243 WP_001295307.1.74267 WP_001295307.1.7429 WP_001295307.1.74294 WP_001295307.1.74309 WP_001295307.1.74358 WP_001295307.1.74365 WP_001295307.1.74367 WP_001295307.1.744 WP_001295307.1.74423 WP_001295307.1.74426 WP_001295307.1.74431 WP_001295307.1.74444 WP_001295307.1.74445 WP_001295307.1.7446 WP_001295307.1.74465 WP_001295307.1.74478 WP_001295307.1.74501 WP_001295307.1.74509 WP_001295307.1.74513 WP_001295307.1.74520 WP_001295307.1.74521 WP_001295307.1.74528 WP_001295307.1.74532 WP_001295307.1.74536 WP_001295307.1.74549 WP_001295307.1.74557 WP_001295307.1.74574 WP_001295307.1.7461 WP_001295307.1.74611 WP_001295307.1.74623 WP_001295307.1.74624 WP_001295307.1.74625 WP_001295307.1.74631 WP_001295307.1.74652 WP_001295307.1.74670 WP_001295307.1.74682 WP_001295307.1.74687 WP_001295307.1.74688 WP_001295307.1.74689 WP_001295307.1.74691 WP_001295307.1.74705 WP_001295307.1.7471 WP_001295307.1.74713 WP_001295307.1.74716 WP_001295307.1.74720 WP_001295307.1.74735 WP_001295307.1.7475 WP_001295307.1.74752 WP_001295307.1.74765 WP_001295307.1.74767 WP_001295307.1.7478 WP_001295307.1.7479 WP_001295307.1.74793 WP_001295307.1.74811 WP_001295307.1.74844 WP_001295307.1.74852 WP_001295307.1.74854 WP_001295307.1.74860 WP_001295307.1.74867 WP_001295307.1.74873 WP_001295307.1.74879 WP_001295307.1.74880 WP_001295307.1.74885 WP_001295307.1.74889 WP_001295307.1.74895 WP_001295307.1.74904 WP_001295307.1.74914 WP_001295307.1.74915 WP_001295307.1.74962 WP_001295307.1.74975 WP_001295307.1.74993 WP_001295307.1.74998 WP_001295307.1.75003 WP_001295307.1.75021 WP_001295307.1.75029 WP_001295307.1.75030 WP_001295307.1.75050 WP_001295307.1.75087 WP_001295307.1.75100 WP_001295307.1.75112 WP_001295307.1.75118 WP_001295307.1.75124 WP_001295307.1.75136 WP_001295307.1.75138 WP_001295307.1.75139 WP_001295307.1.75143 WP_001295307.1.75145 WP_001295307.1.75149 WP_001295307.1.7516 WP_001295307.1.75164 WP_001295307.1.75181 WP_001295307.1.75209 WP_001295307.1.75218 WP_001295307.1.75219 WP_001295307.1.75221 WP_001295307.1.75228 WP_001295307.1.75243 WP_001295307.1.75247 WP_001295307.1.75254 WP_001295307.1.75270 WP_001295307.1.75272 WP_001295307.1.75306 WP_001295307.1.7536 WP_001295307.1.75360 WP_001295307.1.75367 WP_001295307.1.75382 WP_001295307.1.7539 WP_001295307.1.75419 WP_001295307.1.75428 WP_001295307.1.75435 WP_001295307.1.75465 WP_001295307.1.75491 WP_001295307.1.75505 WP_001295307.1.75507 WP_001295307.1.75515 WP_001295307.1.75529 WP_001295307.1.75536 WP_001295307.1.75537 WP_001295307.1.75557 WP_001295307.1.75568 WP_001295307.1.75577 WP_001295307.1.75588 WP_001295307.1.75594 WP_001295307.1.75602 WP_001295307.1.75612 WP_001295307.1.75629 WP_001295307.1.75644 WP_001295307.1.75653 WP_001295307.1.75672 WP_001295307.1.75676 WP_001295307.1.75679 WP_001295307.1.75687 WP_001295307.1.75694 WP_001295307.1.75696 WP_001295307.1.75698 WP_001295307.1.75699 WP_001295307.1.75725 WP_001295307.1.75735 WP_001295307.1.75758 WP_001295307.1.75767 WP_001295307.1.75786 WP_001295307.1.75803 WP_001295307.1.75808 WP_001295307.1.7583 WP_001295307.1.75839 WP_001295307.1.75853 WP_001295307.1.75892 WP_001295307.1.75918 WP_001295307.1.7597 WP_001295307.1.75973 WP_001295307.1.75983 WP_001295307.1.75989 WP_001295307.1.75999 WP_001295307.1.76005 WP_001295307.1.76019 WP_001295307.1.7603 WP_001295307.1.76030 WP_001295307.1.76036 WP_001295307.1.76039 WP_001295307.1.76054 WP_001295307.1.76057 WP_001295307.1.7608 WP_001295307.1.76087 WP_001295307.1.76089 WP_001295307.1.76103 WP_001295307.1.76118 WP_001295307.1.76119 WP_001295307.1.76129 WP_001295307.1.7613 WP_001295307.1.76152 WP_001295307.1.7617 WP_001295307.1.76184 WP_001295307.1.76189 WP_001295307.1.76194 WP_001295307.1.76196 WP_001295307.1.76211 WP_001295307.1.76237 WP_001295307.1.76268 WP_001295307.1.76269 WP_001295307.1.76312 WP_001295307.1.76335 WP_001295307.1.76361 WP_001295307.1.7637 WP_001295307.1.76376 WP_001295307.1.76384 WP_001295307.1.76390 WP_001295307.1.76407 WP_001295307.1.76446 WP_001295307.1.76447 WP_001295307.1.76452 WP_001295307.1.76460 WP_001295307.1.76462 WP_001295307.1.76466 WP_001295307.1.76477 WP_001295307.1.76504 WP_001295307.1.76542 WP_001295307.1.76544 WP_001295307.1.76547 WP_001295307.1.76562 WP_001295307.1.76595 WP_001295307.1.76596 WP_001295307.1.7661 WP_001295307.1.76612 WP_001295307.1.76619 WP_001295307.1.76643 WP_001295307.1.76656 WP_001295307.1.76660 WP_001295307.1.76697 WP_001295307.1.76701 WP_001295307.1.76705 WP_001295307.1.76707 WP_001295307.1.76712 WP_001295307.1.76751 WP_001295307.1.76759 WP_001295307.1.7680 WP_001295307.1.76815 WP_001295307.1.76827 WP_001295307.1.76831 WP_001295307.1.76840 WP_001295307.1.76863 WP_001295307.1.76884 WP_001295307.1.7689 WP_001295307.1.76909 WP_001295307.1.76918 WP_001295307.1.76933 WP_001295307.1.76957 WP_001295307.1.76961 WP_001295307.1.76965 WP_001295307.1.76966 WP_001295307.1.7699 WP_001295307.1.76994 WP_001295307.1.77007 WP_001295307.1.77015 WP_001295307.1.77022 WP_001295307.1.77036 WP_001295307.1.77042 WP_001295307.1.77057 WP_001295307.1.77070 WP_001295307.1.77081 WP_001295307.1.77099 WP_001295307.1.771 WP_001295307.1.77109 WP_001295307.1.77120 WP_001295307.1.77128 WP_001295307.1.77134 WP_001295307.1.77147 WP_001295307.1.77162 WP_001295307.1.77163 WP_001295307.1.77173 WP_001295307.1.77175 WP_001295307.1.77198 WP_001295307.1.77200 WP_001295307.1.77204 WP_001295307.1.77214 WP_001295307.1.77224 WP_001295307.1.77239 WP_001295307.1.77253 WP_001295307.1.77255 WP_001295307.1.77258 WP_001295307.1.77275 WP_001295307.1.7728 WP_001295307.1.77284 WP_001295307.1.77288 WP_001295307.1.7729 WP_001295307.1.77290 WP_001295307.1.77291 WP_001295307.1.77296 WP_001295307.1.77320 WP_001295307.1.77326 WP_001295307.1.77341 WP_001295307.1.77358 WP_001295307.1.77391 WP_001295307.1.77392 WP_001295307.1.77408 WP_001295307.1.77419 WP_001295307.1.77432 WP_001295307.1.77437 WP_001295307.1.77448 WP_001295307.1.77452 WP_001295307.1.77455 WP_001295307.1.77462 WP_001295307.1.7747 WP_001295307.1.77470 WP_001295307.1.77471 WP_001295307.1.77477 WP_001295307.1.77481 WP_001295307.1.77487 WP_001295307.1.77495 WP_001295307.1.775 WP_001295307.1.7750 WP_001295307.1.77503 WP_001295307.1.77511 WP_001295307.1.77542 WP_001295307.1.77551 WP_001295307.1.7756 WP_001295307.1.77577 WP_001295307.1.77581 WP_001295307.1.77595 WP_001295307.1.77600 WP_001295307.1.77608 WP_001295307.1.77626 WP_001295307.1.77632 WP_001295307.1.77636 WP_001295307.1.77643 WP_001295307.1.77644 WP_001295307.1.77648 WP_001295307.1.77657 WP_001295307.1.77707 WP_001295307.1.77725 WP_001295307.1.77741 WP_001295307.1.7775 WP_001295307.1.77760 WP_001295307.1.77767 WP_001295307.1.77768 WP_001295307.1.7780 WP_001295307.1.7781 WP_001295307.1.77813 WP_001295307.1.77816 WP_001295307.1.77826 WP_001295307.1.77833 WP_001295307.1.77876 WP_001295307.1.77929 WP_001295307.1.77949 WP_001295307.1.7795 WP_001295307.1.77950 WP_001295307.1.77961 WP_001295307.1.77979 WP_001295307.1.7799 WP_001295307.1.77999 WP_001295307.1.78000 WP_001295307.1.78007 WP_001295307.1.78010 WP_001295307.1.7804 WP_001295307.1.78041 WP_001295307.1.78059 WP_001295307.1.7806 WP_001295307.1.78063 WP_001295307.1.7808 WP_001295307.1.78089 WP_001295307.1.78097 WP_001295307.1.78099 WP_001295307.1.78101 WP_001295307.1.78131 WP_001295307.1.78183 WP_001295307.1.78187 WP_001295307.1.78188 WP_001295307.1.78196 WP_001295307.1.78202 WP_001295307.1.78232 WP_001295307.1.78233 WP_001295307.1.78297 WP_001295307.1.78305 WP_001295307.1.78321 WP_001295307.1.78337 WP_001295307.1.78340 WP_001295307.1.78368 WP_001295307.1.78377 WP_001295307.1.78390 WP_001295307.1.784 WP_001295307.1.78445 WP_001295307.1.78453 WP_001295307.1.78462 WP_001295307.1.78463 WP_001295307.1.7847 WP_001295307.1.78477 WP_001295307.1.78481 WP_001295307.1.78491 WP_001295307.1.7851 WP_001295307.1.78512 WP_001295307.1.78515 WP_001295307.1.78527 WP_001295307.1.7855 WP_001295307.1.78553 WP_001295307.1.78575 WP_001295307.1.78581 WP_001295307.1.78586 WP_001295307.1.78593 WP_001295307.1.78610 WP_001295307.1.78611 WP_001295307.1.78612 WP_001295307.1.78615 WP_001295307.1.78622 WP_001295307.1.78645 WP_001295307.1.78677 WP_001295307.1.78683 WP_001295307.1.78689 WP_001295307.1.78696 WP_001295307.1.78698 WP_001295307.1.78706 WP_001295307.1.78714 WP_001295307.1.78718 WP_001295307.1.78746 WP_001295307.1.78750 WP_001295307.1.78757 WP_001295307.1.78773 WP_001295307.1.78775 WP_001295307.1.78791 WP_001295307.1.78814 WP_001295307.1.7883 WP_001295307.1.78843 WP_001295307.1.78845 WP_001295307.1.78854 WP_001295307.1.78888 WP_001295307.1.78891 WP_001295307.1.78893 WP_001295307.1.78895 WP_001295307.1.78908 WP_001295307.1.78919 WP_001295307.1.78953 WP_001295307.1.78955 WP_001295307.1.78956 WP_001295307.1.7896 WP_001295307.1.78966 WP_001295307.1.78996 WP_001295307.1.79001 WP_001295307.1.79002 WP_001295307.1.79004 WP_001295307.1.7901 WP_001295307.1.79065 WP_001295307.1.79067 WP_001295307.1.79075 WP_001295307.1.79088 WP_001295307.1.79090 WP_001295307.1.79092 WP_001295307.1.79100 WP_001295307.1.79126 WP_001295307.1.79137 WP_001295307.1.79159 WP_001295307.1.79172 WP_001295307.1.79226 WP_001295307.1.79233 WP_001295307.1.79243 WP_001295307.1.79246 WP_001295307.1.79248 WP_001295307.1.79249 WP_001295307.1.79276 WP_001295307.1.79308 WP_001295307.1.79312 WP_001295307.1.79342 WP_001295307.1.79343 WP_001295307.1.79346 WP_001295307.1.79348 WP_001295307.1.79356 WP_001295307.1.79365 WP_001295307.1.79368 WP_001295307.1.79369 WP_001295307.1.7937 WP_001295307.1.79389 WP_001295307.1.79391 WP_001295307.1.7940 WP_001295307.1.79409 WP_001295307.1.79414 WP_001295307.1.79416 WP_001295307.1.79443 WP_001295307.1.79478 WP_001295307.1.79505 WP_001295307.1.79519 WP_001295307.1.7952 WP_001295307.1.79525 WP_001295307.1.79526 WP_001295307.1.79528 WP_001295307.1.79540 WP_001295307.1.79558 WP_001295307.1.79563 WP_001295307.1.79576 WP_001295307.1.79591 WP_001295307.1.79606 WP_001295307.1.79619 WP_001295307.1.79640 WP_001295307.1.7967 WP_001295307.1.79685 WP_001295307.1.79707 WP_001295307.1.79713 WP_001295307.1.79715 WP_001295307.1.79749 WP_001295307.1.79759 WP_001295307.1.79764 WP_001295307.1.79800 WP_001295307.1.79816 WP_001295307.1.79824 WP_001295307.1.79840 WP_001295307.1.7985 WP_001295307.1.79866 WP_001295307.1.79869 WP_001295307.1.7987 WP_001295307.1.79871 WP_001295307.1.79877 WP_001295307.1.79905 WP_001295307.1.7993 WP_001295307.1.79930 WP_001295307.1.79931 WP_001295307.1.79932 WP_001295307.1.79933 WP_001295307.1.79936 WP_001295307.1.79944 WP_001295307.1.79952 WP_001295307.1.79955 WP_001295307.1.79965 WP_001295307.1.79973 WP_001295307.1.79984 WP_001295307.1.79995 WP_001295307.1.80 WP_001295307.1.80011 WP_001295307.1.80016 WP_001295307.1.80026 WP_001295307.1.8004 WP_001295307.1.80043 WP_001295307.1.80050 WP_001295307.1.80060 WP_001295307.1.80061 WP_001295307.1.80063 WP_001295307.1.8007 WP_001295307.1.80071 WP_001295307.1.80096 WP_001295307.1.80106 WP_001295307.1.8011 WP_001295307.1.80112 WP_001295307.1.80136 WP_001295307.1.80141 WP_001295307.1.80168 WP_001295307.1.80176 WP_001295307.1.80179 WP_001295307.1.80183 WP_001295307.1.80192 WP_001295307.1.80255 WP_001295307.1.80292 WP_001295307.1.80309 WP_001295307.1.80310 WP_001295307.1.80320 WP_001295307.1.80330 WP_001295307.1.80343 WP_001295307.1.80388 WP_001295307.1.80392 WP_001295307.1.804 WP_001295307.1.80402 WP_001295307.1.80426 WP_001295307.1.80440 WP_001295307.1.80456 WP_001295307.1.80484 WP_001295307.1.80517 WP_001295307.1.80519 WP_001295307.1.80524 WP_001295307.1.80545 WP_001295307.1.80558 WP_001295307.1.80559 WP_001295307.1.8057 WP_001295307.1.80577 WP_001295307.1.80578 WP_001295307.1.80594 WP_001295307.1.80606 WP_001295307.1.80612 WP_001295307.1.80626 WP_001295307.1.80660 WP_001295307.1.80662 WP_001295307.1.80676 WP_001295307.1.8068 WP_001295307.1.80709 WP_001295307.1.80718 WP_001295307.1.80731 WP_001295307.1.80736 WP_001295307.1.80737 WP_001295307.1.8074 WP_001295307.1.80753 WP_001295307.1.80754 WP_001295307.1.80756 WP_001295307.1.80768 WP_001295307.1.80789 WP_001295307.1.808 WP_001295307.1.80804 WP_001295307.1.80805 WP_001295307.1.80843 WP_001295307.1.80862 WP_001295307.1.80882 WP_001295307.1.80884 WP_001295307.1.80894 WP_001295307.1.8090 WP_001295307.1.8091 WP_001295307.1.80945 WP_001295307.1.80946 WP_001295307.1.80948 WP_001295307.1.80954 WP_001295307.1.80983 WP_001295307.1.80985 WP_001295307.1.810 WP_001295307.1.81026 WP_001295307.1.81032 WP_001295307.1.81034 WP_001295307.1.81054 WP_001295307.1.81056 WP_001295307.1.81070 WP_001295307.1.81071 WP_001295307.1.81098 WP_001295307.1.811 WP_001295307.1.81104 WP_001295307.1.81120 WP_001295307.1.81127 WP_001295307.1.81141 WP_001295307.1.81156 WP_001295307.1.81160 WP_001295307.1.81165 WP_001295307.1.8118 WP_001295307.1.81180 WP_001295307.1.81182 WP_001295307.1.8121 WP_001295307.1.81219 WP_001295307.1.81266 WP_001295307.1.81267 WP_001295307.1.81273 WP_001295307.1.81281 WP_001295307.1.81283 WP_001295307.1.81286 WP_001295307.1.8129 WP_001295307.1.81298 WP_001295307.1.81313 WP_001295307.1.81316 WP_001295307.1.81323 WP_001295307.1.81347 WP_001295307.1.81376 WP_001295307.1.81391 WP_001295307.1.81396 WP_001295307.1.814 WP_001295307.1.81418 WP_001295307.1.81420 WP_001295307.1.81423 WP_001295307.1.81438 WP_001295307.1.81442 WP_001295307.1.81469 WP_001295307.1.81475 WP_001295307.1.81484 WP_001295307.1.81514 WP_001295307.1.81517 WP_001295307.1.8156 WP_001295307.1.81577 WP_001295307.1.81580 WP_001295307.1.81582 WP_001295307.1.81588 WP_001295307.1.81589 WP_001295307.1.81596 WP_001295307.1.81602 WP_001295307.1.81618 WP_001295307.1.81624 WP_001295307.1.81625 WP_001295307.1.81688 WP_001295307.1.81692 WP_001295307.1.81715 WP_001295307.1.8172 WP_001295307.1.81723 WP_001295307.1.81754 WP_001295307.1.81761 WP_001295307.1.81806 WP_001295307.1.81819 WP_001295307.1.81821 WP_001295307.1.8183 WP_001295307.1.81832 WP_001295307.1.81843 WP_001295307.1.81869 WP_001295307.1.81873 WP_001295307.1.81876 WP_001295307.1.81881 WP_001295307.1.81888 WP_001295307.1.81914 WP_001295307.1.81934 WP_001295307.1.81935 WP_001295307.1.81939 WP_001295307.1.81952 WP_001295307.1.81956 WP_001295307.1.81972 WP_001295307.1.81975 WP_001295307.1.82 WP_001295307.1.82008 WP_001295307.1.82010 WP_001295307.1.82032 WP_001295307.1.82057 WP_001295307.1.82059 WP_001295307.1.82061 WP_001295307.1.82062 WP_001295307.1.82074 WP_001295307.1.82095 WP_001295307.1.82104 WP_001295307.1.82106 WP_001295307.1.82116 WP_001295307.1.82123 WP_001295307.1.82137 WP_001295307.1.82166 WP_001295307.1.82217 WP_001295307.1.82221 WP_001295307.1.82240 WP_001295307.1.82242 WP_001295307.1.82246 WP_001295307.1.82280 WP_001295307.1.82296 WP_001295307.1.82316 WP_001295307.1.82320 WP_001295307.1.82326 WP_001295307.1.82330 WP_001295307.1.8235 WP_001295307.1.82378 WP_001295307.1.82438 WP_001295307.1.82439 WP_001295307.1.82485 WP_001295307.1.82499 WP_001295307.1.82507 WP_001295307.1.82514 WP_001295307.1.82527 WP_001295307.1.82536 WP_001295307.1.82539 WP_001295307.1.8255 WP_001295307.1.82572 WP_001295307.1.82589 WP_001295307.1.82594 WP_001295307.1.82614 WP_001295307.1.82626 WP_001295307.1.82629 WP_001295307.1.82647 WP_001295307.1.82661 WP_001295307.1.8268 WP_001295307.1.82682 WP_001295307.1.82691 WP_001295307.1.82698 WP_001295307.1.82700 WP_001295307.1.82705 WP_001295307.1.82711 WP_001295307.1.82715 WP_001295307.1.82718 WP_001295307.1.82747 WP_001295307.1.82754 WP_001295307.1.8277 WP_001295307.1.82776 WP_001295307.1.82780 WP_001295307.1.82784 WP_001295307.1.82799 WP_001295307.1.82808 WP_001295307.1.82816 WP_001295307.1.82820 WP_001295307.1.82831 WP_001295307.1.82833 WP_001295307.1.82853 WP_001295307.1.82901 WP_001295307.1.82902 WP_001295307.1.82923 WP_001295307.1.8295 WP_001295307.1.82991 WP_001295307.1.83020 WP_001295307.1.83033 WP_001295307.1.83035 WP_001295307.1.83036 WP_001295307.1.83051 WP_001295307.1.83059 WP_001295307.1.8306 WP_001295307.1.8308 WP_001295307.1.83093 WP_001295307.1.83097 WP_001295307.1.83099 WP_001295307.1.831 WP_001295307.1.83118 WP_001295307.1.83125 WP_001295307.1.83127 WP_001295307.1.83140 WP_001295307.1.83144 WP_001295307.1.83160 WP_001295307.1.83177 WP_001295307.1.83205 WP_001295307.1.83214 WP_001295307.1.83218 WP_001295307.1.83238 WP_001295307.1.83253 WP_001295307.1.83256 WP_001295307.1.83286 WP_001295307.1.83313 WP_001295307.1.83321 WP_001295307.1.83330 WP_001295307.1.83340 WP_001295307.1.83347 WP_001295307.1.83375 WP_001295307.1.83393 WP_001295307.1.83415 WP_001295307.1.8345 WP_001295307.1.83466 WP_001295307.1.83506 WP_001295307.1.83537 WP_001295307.1.83544 WP_001295307.1.83564 WP_001295307.1.83582 WP_001295307.1.83584 WP_001295307.1.83644 WP_001295307.1.83660 WP_001295307.1.83668 WP_001295307.1.8368 WP_001295307.1.83684 WP_001295307.1.83712 WP_001295307.1.83735 WP_001295307.1.83762 WP_001295307.1.83781 WP_001295307.1.83820 WP_001295307.1.8384 WP_001295307.1.8386 WP_001295307.1.83879 WP_001295307.1.83936 WP_001295307.1.83941 WP_001295307.1.83947 WP_001295307.1.84004 WP_001295307.1.84021 WP_001295307.1.8405 WP_001295307.1.84059 WP_001295307.1.84060 WP_001295307.1.84074 WP_001295307.1.8408 WP_001295307.1.8411 WP_001295307.1.84140 WP_001295307.1.84164 WP_001295307.1.84172 WP_001295307.1.84185 WP_001295307.1.84197 WP_001295307.1.84210 WP_001295307.1.84215 WP_001295307.1.84219 WP_001295307.1.84221 WP_001295307.1.84264 WP_001295307.1.84298 WP_001295307.1.84312 WP_001295307.1.84313 WP_001295307.1.84316 WP_001295307.1.84319 WP_001295307.1.84326 WP_001295307.1.84331 WP_001295307.1.84339 WP_001295307.1.84348 WP_001295307.1.84405 WP_001295307.1.84410 WP_001295307.1.84436 WP_001295307.1.8444 WP_001295307.1.84462 WP_001295307.1.84464 WP_001295307.1.84467 WP_001295307.1.8447 WP_001295307.1.84473 WP_001295307.1.84476 WP_001295307.1.84482 WP_001295307.1.84484 WP_001295307.1.84486 WP_001295307.1.84511 WP_001295307.1.84518 WP_001295307.1.84531 WP_001295307.1.84534 WP_001295307.1.84584 WP_001295307.1.84635 WP_001295307.1.84639 WP_001295307.1.84656 WP_001295307.1.84657 WP_001295307.1.84668 WP_001295307.1.84675 WP_001295307.1.84697 WP_001295307.1.8470 WP_001295307.1.84731 WP_001295307.1.84738 WP_001295307.1.84740 WP_001295307.1.84768 WP_001295307.1.8477 WP_001295307.1.84784 WP_001295307.1.84797 WP_001295307.1.84841 WP_001295307.1.84850 WP_001295307.1.84875 WP_001295307.1.84878 WP_001295307.1.84881 WP_001295307.1.84893 WP_001295307.1.84894 WP_001295307.1.84916 WP_001295307.1.84929 WP_001295307.1.84941 WP_001295307.1.84948 WP_001295307.1.84972 WP_001295307.1.84977 WP_001295307.1.84986 WP_001295307.1.84989 WP_001295307.1.84990 WP_001295307.1.84994 WP_001295307.1.85002 WP_001295307.1.85008 WP_001295307.1.85011 WP_001295307.1.85025 WP_001295307.1.85048 WP_001295307.1.85052 WP_001295307.1.85077 WP_001295307.1.85090 WP_001295307.1.85098 WP_001295307.1.85105 WP_001295307.1.85106 WP_001295307.1.85112 WP_001295307.1.85125 WP_001295307.1.85129 WP_001295307.1.85138 WP_001295307.1.85141 WP_001295307.1.85155 WP_001295307.1.85156 WP_001295307.1.8517 WP_001295307.1.85175 WP_001295307.1.85188 WP_001295307.1.85216 WP_001295307.1.85241 WP_001295307.1.85247 WP_001295307.1.85252 WP_001295307.1.85253 WP_001295307.1.85255 WP_001295307.1.85260 WP_001295307.1.8530 WP_001295307.1.85305 WP_001295307.1.85310 WP_001295307.1.85323 WP_001295307.1.85329 WP_001295307.1.85335 WP_001295307.1.85336 WP_001295307.1.85342 WP_001295307.1.85361 WP_001295307.1.85369 WP_001295307.1.85385 WP_001295307.1.85416 WP_001295307.1.85435 WP_001295307.1.85500 WP_001295307.1.85504 WP_001295307.1.85525 WP_001295307.1.85546 WP_001295307.1.85554 WP_001295307.1.85556 WP_001295307.1.85558 WP_001295307.1.85563 WP_001295307.1.85578 WP_001295307.1.85593 WP_001295307.1.8560 WP_001295307.1.85601 WP_001295307.1.85621 WP_001295307.1.85623 WP_001295307.1.8564 WP_001295307.1.85657 WP_001295307.1.85685 WP_001295307.1.85722 WP_001295307.1.85752 WP_001295307.1.85762 WP_001295307.1.85767 WP_001295307.1.85772 WP_001295307.1.85773 WP_001295307.1.85781 WP_001295307.1.8579 WP_001295307.1.85793 WP_001295307.1.85800 WP_001295307.1.85806 WP_001295307.1.85857 WP_001295307.1.85895 WP_001295307.1.8592 WP_001295307.1.85939 WP_001295307.1.85944 WP_001295307.1.85948 WP_001295307.1.85969 WP_001295307.1.86 WP_001295307.1.86001 WP_001295307.1.86016 WP_001295307.1.8603 WP_001295307.1.86035 WP_001295307.1.86063 WP_001295307.1.86104 WP_001295307.1.86105 WP_001295307.1.86110 WP_001295307.1.86115 WP_001295307.1.86145 WP_001295307.1.86149 WP_001295307.1.86161 WP_001295307.1.86166 WP_001295307.1.86171 WP_001295307.1.86176 WP_001295307.1.86179 WP_001295307.1.86181 WP_001295307.1.86189 WP_001295307.1.86196 WP_001295307.1.8621 WP_001295307.1.86210 WP_001295307.1.86225 WP_001295307.1.86227 WP_001295307.1.86228 WP_001295307.1.86234 WP_001295307.1.86255 WP_001295307.1.86261 WP_001295307.1.86263 WP_001295307.1.86266 WP_001295307.1.86273 WP_001295307.1.86276 WP_001295307.1.86280 WP_001295307.1.86283 WP_001295307.1.86294 WP_001295307.1.86307 WP_001295307.1.86340 WP_001295307.1.8635 WP_001295307.1.86355 WP_001295307.1.86364 WP_001295307.1.86371 WP_001295307.1.86376 WP_001295307.1.86393 WP_001295307.1.86411 WP_001295307.1.86412 WP_001295307.1.86437 WP_001295307.1.86451 WP_001295307.1.86452 WP_001295307.1.86454 WP_001295307.1.86461 WP_001295307.1.86475 WP_001295307.1.86483 WP_001295307.1.86492 WP_001295307.1.86518 WP_001295307.1.8652 WP_001295307.1.8656 WP_001295307.1.86560 WP_001295307.1.86574 WP_001295307.1.86583 WP_001295307.1.86586 WP_001295307.1.86598 WP_001295307.1.86609 WP_001295307.1.86613 WP_001295307.1.86617 WP_001295307.1.86627 WP_001295307.1.86640 WP_001295307.1.86667 WP_001295307.1.86673 WP_001295307.1.86681 WP_001295307.1.86691 WP_001295307.1.86707 WP_001295307.1.86727 WP_001295307.1.86731 WP_001295307.1.86734 WP_001295307.1.86753 WP_001295307.1.86760 WP_001295307.1.86787 WP_001295307.1.86788 WP_001295307.1.86833 WP_001295307.1.86846 WP_001295307.1.86848 WP_001295307.1.8687 WP_001295307.1.86935 WP_001295307.1.86956 WP_001295307.1.86959 WP_001295307.1.86975 WP_001295307.1.86994 WP_001295307.1.86997 WP_001295307.1.87043 WP_001295307.1.8705 WP_001295307.1.87059 WP_001295307.1.87067 WP_001295307.1.87074 WP_001295307.1.87075 WP_001295307.1.87076 WP_001295307.1.87102 WP_001295307.1.87109 WP_001295307.1.87177 WP_001295307.1.87189 WP_001295307.1.87199 WP_001295307.1.87205 WP_001295307.1.87247 WP_001295307.1.87249 WP_001295307.1.87254 WP_001295307.1.87310 WP_001295307.1.87339 WP_001295307.1.87358 WP_001295307.1.87371 WP_001295307.1.87382 WP_001295307.1.87389 WP_001295307.1.87400 WP_001295307.1.87410 WP_001295307.1.87443 WP_001295307.1.87465 WP_001295307.1.87491 WP_001295307.1.87504 WP_001295307.1.87563 WP_001295307.1.87568 WP_001295307.1.87574 WP_001295307.1.87581 WP_001295307.1.87590 WP_001295307.1.87607 WP_001295307.1.87608 WP_001295307.1.87610 WP_001295307.1.87616 WP_001295307.1.87639 WP_001295307.1.87655 WP_001295307.1.87675 WP_001295307.1.87694 WP_001295307.1.87696 WP_001295307.1.8771 WP_001295307.1.87721 WP_001295307.1.87726 WP_001295307.1.87728 WP_001295307.1.87738 WP_001295307.1.87766 WP_001295307.1.8778 WP_001295307.1.87786 WP_001295307.1.87788 WP_001295307.1.87789 WP_001295307.1.87834 WP_001295307.1.87857 WP_001295307.1.87883 WP_001295307.1.87914 WP_001295307.1.87919 WP_001295307.1.87973 WP_001295307.1.87976 WP_001295307.1.87980 WP_001295307.1.87984 WP_001295307.1.87989 WP_001295307.1.87990 WP_001295307.1.880 WP_001295307.1.88017 WP_001295307.1.88020 WP_001295307.1.88066 WP_001295307.1.8807 WP_001295307.1.88082 WP_001295307.1.88088 WP_001295307.1.88110 WP_001295307.1.88119 WP_001295307.1.88147 WP_001295307.1.88149 WP_001295307.1.88155 WP_001295307.1.88189 WP_001295307.1.88197 WP_001295307.1.8822 WP_001295307.1.88234 WP_001295307.1.88238 WP_001295307.1.88252 WP_001295307.1.88260 WP_001295307.1.88285 WP_001295307.1.88301 WP_001295307.1.88304 WP_001295307.1.88336 WP_001295307.1.88352 WP_001295307.1.88376 WP_001295307.1.88379 WP_001295307.1.88384 WP_001295307.1.88413 WP_001295307.1.88427 WP_001295307.1.8843 WP_001295307.1.88434 WP_001295307.1.88438 WP_001295307.1.88462 WP_001295307.1.88467 WP_001295307.1.8848 WP_001295307.1.88499 WP_001295307.1.88505 WP_001295307.1.88524 WP_001295307.1.88527 WP_001295307.1.88535 WP_001295307.1.88539 WP_001295307.1.8854 WP_001295307.1.8855 WP_001295307.1.88562 WP_001295307.1.88577 WP_001295307.1.88598 WP_001295307.1.88603 WP_001295307.1.88607 WP_001295307.1.88631 WP_001295307.1.88646 WP_001295307.1.88667 WP_001295307.1.88678 WP_001295307.1.88685 WP_001295307.1.88686 WP_001295307.1.88709 WP_001295307.1.88710 WP_001295307.1.88711 WP_001295307.1.88717 WP_001295307.1.88720 WP_001295307.1.88729 WP_001295307.1.8873 WP_001295307.1.88732 WP_001295307.1.88735 WP_001295307.1.88752 WP_001295307.1.88757 WP_001295307.1.88759 WP_001295307.1.88767 WP_001295307.1.88793 WP_001295307.1.88803 WP_001295307.1.88864 WP_001295307.1.88880 WP_001295307.1.88883 WP_001295307.1.88891 WP_001295307.1.88941 WP_001295307.1.88950 WP_001295307.1.88953 WP_001295307.1.88961 WP_001295307.1.88997 WP_001295307.1.89018 WP_001295307.1.89043 WP_001295307.1.89050 WP_001295307.1.8906 WP_001295307.1.89067 WP_001295307.1.89069 WP_001295307.1.89090 WP_001295307.1.89097 WP_001295307.1.89099 WP_001295307.1.89111 WP_001295307.1.89150 WP_001295307.1.89163 WP_001295307.1.89165 WP_001295307.1.89183 WP_001295307.1.89197 WP_001295307.1.89203 WP_001295307.1.89214 WP_001295307.1.89217 WP_001295307.1.89255 WP_001295307.1.89285 WP_001295307.1.89305 WP_001295307.1.89312 WP_001295307.1.89322 WP_001295307.1.89334 WP_001295307.1.89335 WP_001295307.1.89351 WP_001295307.1.89379 WP_001295307.1.8938 WP_001295307.1.89385 WP_001295307.1.89396 WP_001295307.1.894 WP_001295307.1.89400 WP_001295307.1.89403 WP_001295307.1.89405 WP_001295307.1.89416 WP_001295307.1.89427 WP_001295307.1.89432 WP_001295307.1.8945 WP_001295307.1.89455 WP_001295307.1.89458 WP_001295307.1.89466 WP_001295307.1.89468 WP_001295307.1.89469 WP_001295307.1.89474 WP_001295307.1.89479 WP_001295307.1.89492 WP_001295307.1.89510 WP_001295307.1.89551 WP_001295307.1.89569 WP_001295307.1.89583 WP_001295307.1.89601 WP_001295307.1.89627 WP_001295307.1.89631 WP_001295307.1.89646 WP_001295307.1.89656 WP_001295307.1.89674 WP_001295307.1.89679 WP_001295307.1.89747 WP_001295307.1.89768 WP_001295307.1.89781 WP_001295307.1.89788 WP_001295307.1.89839 WP_001295307.1.89841 WP_001295307.1.89879 WP_001295307.1.89895 WP_001295307.1.89899 WP_001295307.1.89915 WP_001295307.1.89917 WP_001295307.1.89918 WP_001295307.1.89920 WP_001295307.1.89923 WP_001295307.1.89927 WP_001295307.1.89959 WP_001295307.1.89977 WP_001295307.1.89988 WP_001295307.1.89998 WP_001295307.1.90017 WP_001295307.1.90022 WP_001295307.1.90050 WP_001295307.1.90063 WP_001295307.1.90065 WP_001295307.1.90078 WP_001295307.1.9009 WP_001295307.1.9010 WP_001295307.1.90115 WP_001295307.1.90128 WP_001295307.1.90139 WP_001295307.1.90146 WP_001295307.1.90156 WP_001295307.1.90168 WP_001295307.1.90171 WP_001295307.1.90182 WP_001295307.1.902 WP_001295307.1.90205 WP_001295307.1.90219 WP_001295307.1.90249 WP_001295307.1.90256 WP_001295307.1.90257 WP_001295307.1.90266 WP_001295307.1.90270 WP_001295307.1.90314 WP_001295307.1.90332 WP_001295307.1.90342 WP_001295307.1.90346 WP_001295307.1.90349 WP_001295307.1.90357 WP_001295307.1.90358 WP_001295307.1.9036 WP_001295307.1.9037 WP_001295307.1.90389 WP_001295307.1.90405 WP_001295307.1.90435 WP_001295307.1.90436 WP_001295307.1.90441 WP_001295307.1.90449 WP_001295307.1.90467 WP_001295307.1.90511 WP_001295307.1.90520 WP_001295307.1.90525 WP_001295307.1.90536 WP_001295307.1.90542 WP_001295307.1.90547 WP_001295307.1.9059 WP_001295307.1.90591 WP_001295307.1.90602 WP_001295307.1.90626 WP_001295307.1.90690 WP_001295307.1.90703 WP_001295307.1.90758 WP_001295307.1.90775 WP_001295307.1.90799 WP_001295307.1.9081 WP_001295307.1.90813 WP_001295307.1.90822 WP_001295307.1.90828 WP_001295307.1.90837 WP_001295307.1.90839 WP_001295307.1.9084 WP_001295307.1.90842 WP_001295307.1.90844 WP_001295307.1.90848 WP_001295307.1.90856 WP_001295307.1.90864 WP_001295307.1.90865 WP_001295307.1.9087 WP_001295307.1.90873 WP_001295307.1.90890 WP_001295307.1.909 WP_001295307.1.90905 WP_001295307.1.90924 WP_001295307.1.90951 WP_001295307.1.90960 WP_001295307.1.90967 WP_001295307.1.90979 WP_001295307.1.9098 WP_001295307.1.90988 WP_001295307.1.90996 WP_001295307.1.90997 WP_001295307.1.91 WP_001295307.1.91007 WP_001295307.1.91010 WP_001295307.1.91018 WP_001295307.1.9104 WP_001295307.1.91072 WP_001295307.1.91088 WP_001295307.1.91113 WP_001295307.1.91117 WP_001295307.1.91121 WP_001295307.1.91138 WP_001295307.1.91143 WP_001295307.1.91153 WP_001295307.1.91170 WP_001295307.1.9118 WP_001295307.1.9119 WP_001295307.1.91213 WP_001295307.1.91220 WP_001295307.1.91266 WP_001295307.1.91268 WP_001295307.1.91277 WP_001295307.1.91288 WP_001295307.1.91290 WP_001295307.1.91340 WP_001295307.1.91341 WP_001295307.1.91354 WP_001295307.1.91356 WP_001295307.1.91361 WP_001295307.1.91384 WP_001295307.1.91397 WP_001295307.1.91425 WP_001295307.1.91445 WP_001295307.1.91462 WP_001295307.1.91482 WP_001295307.1.91485 WP_001295307.1.915 WP_001295307.1.91511 WP_001295307.1.91515 WP_001295307.1.91516 WP_001295307.1.91526 WP_001295307.1.91543 WP_001295307.1.91548 WP_001295307.1.91549 WP_001295307.1.91551 WP_001295307.1.91565 WP_001295307.1.91566 WP_001295307.1.9157 WP_001295307.1.91594 WP_001295307.1.91596 WP_001295307.1.9160 WP_001295307.1.91626 WP_001295307.1.91630 WP_001295307.1.91640 WP_001295307.1.91643 WP_001295307.1.91644 WP_001295307.1.91651 WP_001295307.1.91666 WP_001295307.1.91672 WP_001295307.1.9168 WP_001295307.1.91685 WP_001295307.1.9169 WP_001295307.1.91701 WP_001295307.1.9171 WP_001295307.1.91739 WP_001295307.1.91756 WP_001295307.1.91777 WP_001295307.1.91779 WP_001295307.1.91782 WP_001295307.1.91793 WP_001295307.1.91801 WP_001295307.1.91814 WP_001295307.1.91843 WP_001295307.1.91871 WP_001295307.1.91879 WP_001295307.1.91887 WP_001295307.1.91893 WP_001295307.1.91951 WP_001295307.1.91954 WP_001295307.1.91959 WP_001295307.1.91965 WP_001295307.1.91971 WP_001295307.1.9199 WP_001295307.1.91994 WP_001295307.1.92005 WP_001295307.1.92014 WP_001295307.1.92019 WP_001295307.1.92025 WP_001295307.1.92029 WP_001295307.1.92031 WP_001295307.1.92048 WP_001295307.1.92053 WP_001295307.1.92058 WP_001295307.1.9209 WP_001295307.1.92096 WP_001295307.1.921 WP_001295307.1.92102 WP_001295307.1.92114 WP_001295307.1.92123 WP_001295307.1.9215 WP_001295307.1.92161 WP_001295307.1.92163 WP_001295307.1.92195 WP_001295307.1.92201 WP_001295307.1.92215 WP_001295307.1.92224 WP_001295307.1.92276 WP_001295307.1.92304 WP_001295307.1.92305 WP_001295307.1.92311 WP_001295307.1.92323 WP_001295307.1.92361 WP_001295307.1.92384 WP_001295307.1.924 WP_001295307.1.92403 WP_001295307.1.92434 WP_001295307.1.92462 WP_001295307.1.92473 WP_001295307.1.92495 WP_001295307.1.92496 WP_001295307.1.92506 WP_001295307.1.92532 WP_001295307.1.92535 WP_001295307.1.9255 WP_001295307.1.92568 WP_001295307.1.92577 WP_001295307.1.92614 WP_001295307.1.92615 WP_001295307.1.92634 WP_001295307.1.92638 WP_001295307.1.9264 WP_001295307.1.92648 WP_001295307.1.9266 WP_001295307.1.92668 WP_001295307.1.92693 WP_001295307.1.92708 WP_001295307.1.92719 WP_001295307.1.92742 WP_001295307.1.92750 WP_001295307.1.92780 WP_001295307.1.92781 WP_001295307.1.92792 WP_001295307.1.92793 WP_001295307.1.92796 WP_001295307.1.92819 WP_001295307.1.92845 WP_001295307.1.92865 WP_001295307.1.92882 WP_001295307.1.92886 WP_001295307.1.92932 WP_001295307.1.92943 WP_001295307.1.92953 WP_001295307.1.92989 WP_001295307.1.92991 WP_001295307.1.93005 WP_001295307.1.93016 WP_001295307.1.93017 WP_001295307.1.93019 WP_001295307.1.93023 WP_001295307.1.93027 WP_001295307.1.93033 WP_001295307.1.93048 WP_001295307.1.93052 WP_001295307.1.93069 WP_001295307.1.93072 WP_001295307.1.93085 WP_001295307.1.93100 WP_001295307.1.93112 WP_001295307.1.93133 WP_001295307.1.93138 WP_001295307.1.93139 WP_001295307.1.93167 WP_001295307.1.93175 WP_001295307.1.93233 WP_001295307.1.93252 WP_001295307.1.93267 WP_001295307.1.9327 WP_001295307.1.93276 WP_001295307.1.93291 WP_001295307.1.9331 WP_001295307.1.93312 WP_001295307.1.93326 WP_001295307.1.93338 WP_001295307.1.93379 WP_001295307.1.93388 WP_001295307.1.934 WP_001295307.1.93427 WP_001295307.1.93428 WP_001295307.1.93453 WP_001295307.1.93461 WP_001295307.1.93464 WP_001295307.1.93468 WP_001295307.1.93509 WP_001295307.1.93531 WP_001295307.1.93533 WP_001295307.1.93552 WP_001295307.1.9356 WP_001295307.1.93569 WP_001295307.1.93601 WP_001295307.1.93605 WP_001295307.1.93629 WP_001295307.1.93630 WP_001295307.1.93634 WP_001295307.1.93637 WP_001295307.1.93652 WP_001295307.1.93665 WP_001295307.1.93670 WP_001295307.1.93673 WP_001295307.1.93679 WP_001295307.1.93694 WP_001295307.1.93695 WP_001295307.1.93716 WP_001295307.1.93737 WP_001295307.1.93742 WP_001295307.1.93743 WP_001295307.1.93755 WP_001295307.1.93765 WP_001295307.1.93768 WP_001295307.1.938 WP_001295307.1.93800 WP_001295307.1.93821 WP_001295307.1.93870 WP_001295307.1.93873 WP_001295307.1.93877 WP_001295307.1.939 WP_001295307.1.93900 WP_001295307.1.93911 WP_001295307.1.93918 WP_001295307.1.93921 WP_001295307.1.93922 WP_001295307.1.93939 WP_001295307.1.93952 WP_001295307.1.93971 WP_001295307.1.94008 WP_001295307.1.94011 WP_001295307.1.94025 WP_001295307.1.94028 WP_001295307.1.94035 WP_001295307.1.94040 WP_001295307.1.94057 WP_001295307.1.94069 WP_001295307.1.94156 WP_001295307.1.94176 WP_001295307.1.94187 WP_001295307.1.94190 WP_001295307.1.9420 WP_001295307.1.94213 WP_001295307.1.94232 WP_001295307.1.94271 WP_001295307.1.94282 WP_001295307.1.94298 WP_001295307.1.94302 WP_001295307.1.94317 WP_001295307.1.94343 WP_001295307.1.94353 WP_001295307.1.94367 WP_001295307.1.94388 WP_001295307.1.94404 WP_001295307.1.94417 WP_001295307.1.94429 WP_001295307.1.94430 WP_001295307.1.94436 WP_001295307.1.94438 WP_001295307.1.94445 WP_001295307.1.94446 WP_001295307.1.94468 WP_001295307.1.94475 WP_001295307.1.94497 WP_001295307.1.94507 WP_001295307.1.94516 WP_001295307.1.94523 WP_001295307.1.94542 WP_001295307.1.94544 WP_001295307.1.94548 WP_001295307.1.9457 WP_001295307.1.94578 WP_001295307.1.94580 WP_001295307.1.94589 WP_001295307.1.94619 WP_001295307.1.94626 WP_001295307.1.94646 WP_001295307.1.94653 WP_001295307.1.94676 WP_001295307.1.94686 WP_001295307.1.94690 WP_001295307.1.94692 WP_001295307.1.94695 WP_001295307.1.94704 WP_001295307.1.94738 WP_001295307.1.94739 WP_001295307.1.9474 WP_001295307.1.94753 WP_001295307.1.94754 WP_001295307.1.94764 WP_001295307.1.94787 WP_001295307.1.94790 WP_001295307.1.948 WP_001295307.1.94801 WP_001295307.1.94806 WP_001295307.1.94808 WP_001295307.1.94822 WP_001295307.1.94823 WP_001295307.1.94836 WP_001295307.1.94841 WP_001295307.1.94847 WP_001295307.1.94869 WP_001295307.1.94877 WP_001295307.1.94880 WP_001295307.1.94889 WP_001295307.1.9489 WP_001295307.1.94892 WP_001295307.1.94898 WP_001295307.1.949 WP_001295307.1.94903 WP_001295307.1.9491 WP_001295307.1.94927 WP_001295307.1.94934 WP_001295307.1.94935 WP_001295307.1.94938 WP_001295307.1.94949 WP_001295307.1.94955 WP_001295307.1.94963 WP_001295307.1.94991 WP_001295307.1.94993 WP_001295307.1.94997 WP_001295307.1.95005 WP_001295307.1.95011 WP_001295307.1.95022 WP_001295307.1.95028 WP_001295307.1.95035 WP_001295307.1.95036 WP_001295307.1.95037 WP_001295307.1.95062 WP_001295307.1.95080 WP_001295307.1.95084 WP_001295307.1.95105 WP_001295307.1.95129 WP_001295307.1.9513 WP_001295307.1.95161 WP_001295307.1.95198 WP_001295307.1.95233 WP_001295307.1.95243 WP_001295307.1.95244 WP_001295307.1.95254 WP_001295307.1.95275 WP_001295307.1.95310 WP_001295307.1.95329 WP_001295307.1.95332 WP_001295307.1.95364 WP_001295307.1.95366 WP_001295307.1.95368 WP_001295307.1.95378 WP_001295307.1.95381 WP_001295307.1.95390 WP_001295307.1.95395 WP_001295307.1.95398 WP_001295307.1.95400 WP_001295307.1.95403 WP_001295307.1.95424 WP_001295307.1.95428 WP_001295307.1.95431 WP_001295307.1.95438 WP_001295307.1.95449 WP_001295307.1.95490 WP_001295307.1.95518 WP_001295307.1.95521 WP_001295307.1.95563 WP_001295307.1.9559 WP_001295307.1.95595 WP_001295307.1.95596 WP_001295307.1.95604 WP_001295307.1.95611 WP_001295307.1.95628 WP_001295307.1.95634 WP_001295307.1.95655 WP_001295307.1.9566 WP_001295307.1.95666 WP_001295307.1.95680 WP_001295307.1.95712 WP_001295307.1.95756 WP_001295307.1.95759 WP_001295307.1.95771 WP_001295307.1.95783 WP_001295307.1.95784 WP_001295307.1.95801 WP_001295307.1.95821 WP_001295307.1.95824 WP_001295307.1.95827 WP_001295307.1.95834 WP_001295307.1.95835 WP_001295307.1.95846 WP_001295307.1.95858 WP_001295307.1.95865 WP_001295307.1.95869 WP_001295307.1.95916 WP_001295307.1.95919 WP_001295307.1.95929 WP_001295307.1.95931 WP_001295307.1.95932 WP_001295307.1.95951 WP_001295307.1.960 WP_001295307.1.96015 WP_001295307.1.96032 WP_001295307.1.96053 WP_001295307.1.96059 WP_001295307.1.96066 WP_001295307.1.96086 WP_001295307.1.96097 WP_001295307.1.96110 WP_001295307.1.96114 WP_001295307.1.96128 WP_001295307.1.96143 WP_001295307.1.96145 WP_001295307.1.9616 WP_001295307.1.96177 WP_001295307.1.96215 WP_001295307.1.96222 WP_001295307.1.96223 WP_001295307.1.96229 WP_001295307.1.96247 WP_001295307.1.96253 WP_001295307.1.96263 WP_001295307.1.96278 WP_001295307.1.96279 WP_001295307.1.96281 WP_001295307.1.96290 WP_001295307.1.96293 WP_001295307.1.96303 WP_001295307.1.9631 WP_001295307.1.96339 WP_001295307.1.96341 WP_001295307.1.96378 WP_001295307.1.96392 WP_001295307.1.96394 WP_001295307.1.9641 WP_001295307.1.96417 WP_001295307.1.96420 WP_001295307.1.96425 WP_001295307.1.96450 WP_001295307.1.96457 WP_001295307.1.96478 WP_001295307.1.96479 WP_001295307.1.96484 WP_001295307.1.9649 WP_001295307.1.96494 WP_001295307.1.96519 WP_001295307.1.96541 WP_001295307.1.96558 WP_001295307.1.96562 WP_001295307.1.9657 WP_001295307.1.96585 WP_001295307.1.96608 WP_001295307.1.96609 WP_001295307.1.9661 WP_001295307.1.96617 WP_001295307.1.96633 WP_001295307.1.96650 WP_001295307.1.96659 WP_001295307.1.96676 WP_001295307.1.9668 WP_001295307.1.96680 WP_001295307.1.96683 WP_001295307.1.96695 WP_001295307.1.96701 WP_001295307.1.9671 WP_001295307.1.96725 WP_001295307.1.96743 WP_001295307.1.96753 WP_001295307.1.96759 WP_001295307.1.96762 WP_001295307.1.96769 WP_001295307.1.96779 WP_001295307.1.96797 WP_001295307.1.96817 WP_001295307.1.9682 WP_001295307.1.96820 WP_001295307.1.96850 WP_001295307.1.96864 WP_001295307.1.96894 WP_001295307.1.9690 WP_001295307.1.96907 WP_001295307.1.96924 WP_001295307.1.96932 WP_001295307.1.96936 WP_001295307.1.96944 WP_001295307.1.96984 WP_001295307.1.96989 WP_001295307.1.97011 WP_001295307.1.97027 WP_001295307.1.97049 WP_001295307.1.97059 WP_001295307.1.9708 WP_001295307.1.97119 WP_001295307.1.97123 WP_001295307.1.97147 WP_001295307.1.97170 WP_001295307.1.97193 WP_001295307.1.97195 WP_001295307.1.97200 WP_001295307.1.97226 WP_001295307.1.9723 WP_001295307.1.97238 WP_001295307.1.97247 WP_001295307.1.97248 WP_001295307.1.97269 WP_001295307.1.97279 WP_001295307.1.97282 WP_001295307.1.9729 WP_001295307.1.97292 WP_001295307.1.97344 WP_001295307.1.97351 WP_001295307.1.97356 WP_001295307.1.97360 WP_001295307.1.97361 WP_001295307.1.97379 WP_001295307.1.97387 WP_001295307.1.9740 WP_001295307.1.97402 WP_001295307.1.97418 WP_001295307.1.97421 WP_001295307.1.97434 WP_001295307.1.97437 WP_001295307.1.97439 WP_001295307.1.97459 WP_001295307.1.97464 WP_001295307.1.9747 WP_001295307.1.97490 WP_001295307.1.97513 WP_001295307.1.97525 WP_001295307.1.97527 WP_001295307.1.97538 WP_001295307.1.97544 WP_001295307.1.97549 WP_001295307.1.97560 WP_001295307.1.97571 WP_001295307.1.97619 WP_001295307.1.97632 WP_001295307.1.97654 WP_001295307.1.97667 WP_001295307.1.97675 WP_001295307.1.97677 WP_001295307.1.97685 WP_001295307.1.9770 WP_001295307.1.97705 WP_001295307.1.97711 WP_001295307.1.97770 WP_001295307.1.97775 WP_001295307.1.97778 WP_001295307.1.97789 WP_001295307.1.97798 WP_001295307.1.978 WP_001295307.1.97802 WP_001295307.1.97815 WP_001295307.1.97822 WP_001295307.1.97823 WP_001295307.1.97825 WP_001295307.1.97871 WP_001295307.1.97890 WP_001295307.1.97895 WP_001295307.1.97919 WP_001295307.1.97930 WP_001295307.1.97932 WP_001295307.1.97937 WP_001295307.1.97962 WP_001295307.1.97982 WP_001295307.1.97996 WP_001295307.1.98000 WP_001295307.1.98005 WP_001295307.1.98012 WP_001295307.1.98026 WP_001295307.1.9803 WP_001295307.1.98046 WP_001295307.1.98082 WP_001295307.1.98083 WP_001295307.1.981 WP_001295307.1.98102 WP_001295307.1.98115 WP_001295307.1.98139 WP_001295307.1.98155 WP_001295307.1.9816 WP_001295307.1.98167 WP_001295307.1.9817 WP_001295307.1.98176 WP_001295307.1.98187 WP_001295307.1.98202 WP_001295307.1.98205 WP_001295307.1.98208 WP_001295307.1.98220 WP_001295307.1.98232 WP_001295307.1.98235 WP_001295307.1.98239 WP_001295307.1.98241 WP_001295307.1.98244 WP_001295307.1.98251 WP_001295307.1.98279 WP_001295307.1.98284 WP_001295307.1.98292 WP_001295307.1.98294 WP_001295307.1.98301 WP_001295307.1.98312 WP_001295307.1.98323 WP_001295307.1.98355 WP_001295307.1.98357 WP_001295307.1.98384 WP_001295307.1.98400 WP_001295307.1.98404 WP_001295307.1.98424 WP_001295307.1.98429 WP_001295307.1.9844 WP_001295307.1.98442 WP_001295307.1.98451 WP_001295307.1.98466 WP_001295307.1.98480 WP_001295307.1.98484 WP_001295307.1.98498 WP_001295307.1.98543 WP_001295307.1.98549 WP_001295307.1.98569 WP_001295307.1.98578 WP_001295307.1.9858 WP_001295307.1.98587 WP_001295307.1.98603 WP_001295307.1.98614 WP_001295307.1.98626 WP_001295307.1.98628 WP_001295307.1.98633 WP_001295307.1.9864 WP_001295307.1.98641 WP_001295307.1.98654 WP_001295307.1.98665 WP_001295307.1.98668 WP_001295307.1.98702 WP_001295307.1.98727 WP_001295307.1.98757 WP_001295307.1.98775 WP_001295307.1.98776 WP_001295307.1.98784 WP_001295307.1.9883 WP_001295307.1.98875 WP_001295307.1.98886 WP_001295307.1.98908 WP_001295307.1.98920 WP_001295307.1.98976 WP_001295307.1.98988 WP_001295307.1.99006 WP_001295307.1.99029 WP_001295307.1.99046 WP_001295307.1.99053 WP_001295307.1.99060 WP_001295307.1.9907 WP_001295307.1.99101 WP_001295307.1.99110 WP_001295307.1.99119 WP_001295307.1.99168 WP_001295307.1.99182 WP_001295307.1.99209 WP_001295307.1.99234 WP_001295307.1.99246 WP_001295307.1.99289 WP_001295307.1.99292 WP_001295307.1.99295 WP_001295307.1.9930 WP_001295307.1.99302 WP_001295307.1.99304 WP_001295307.1.99306 WP_001295307.1.99307 WP_001295307.1.99310 WP_001295307.1.99319 WP_001295307.1.99334 WP_001295307.1.99345 WP_001295307.1.99349 WP_001295307.1.9935 WP_001295307.1.99361 WP_001295307.1.99392 WP_001295307.1.9940 WP_001295307.1.99400 WP_001295307.1.99401 WP_001295307.1.99427 WP_001295307.1.99446 WP_001295307.1.99453 WP_001295307.1.99458 WP_001295307.1.99471 WP_001295307.1.99475 WP_001295307.1.99486 WP_001295307.1.99487 WP_001295307.1.99498 WP_001295307.1.9950 WP_001295307.1.99501 WP_001295307.1.99511 WP_001295307.1.99534 WP_001295307.1.99549 WP_001295307.1.99562 WP_001295307.1.99571 WP_001295307.1.99592 WP_001295307.1.99602 WP_001295307.1.99603 WP_001295307.1.99619 WP_001295307.1.99632 WP_001295307.1.99641 WP_001295307.1.99666 WP_001295307.1.99692 WP_001295307.1.99694 WP_001295307.1.99698 WP_001295307.1.99734 WP_001295307.1.99771 WP_001295307.1.99774 WP_001295307.1.99782 WP_001295307.1.99791 WP_001295307.1.99804 WP_001295307.1.99827 WP_001295307.1.99869 WP_001295307.1.99874 WP_001295307.1.99891 WP_001295307.1.99892 WP_001295307.1.99912 WP_001295307.1.99929 WP_001295307.1.99986 YP_002406741.1.10275 YP_002411586.1.14968 YP_006119025.1.29421 YP_006780261.1.12065 gi|222155471|ref|YP_002555610.1| gi|378713896|ref|YP_005278789.1| gi|386703908|ref|YP_006167755.1| gi|386605362|ref|YP_006111662.1| gi|16128715|ref|NP_415268.1| gi|387616003|ref|YP_006119025.1| gi|388476832|ref|YP_489020.1| gi|215485762|ref|YP_002328193.1| gi|253774289|ref|YP_003037120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]