SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386340832|ref|YP_006037198.1| from Shewanella baltica OS117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386340832|ref|YP_006037198.1|
Domain Number 1 Region: 25-74,276-511
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.96e-64
Family Bacterial dinuclear zinc exopeptidases 0.026
Further Details:      
 
Domain Number 2 Region: 124-207
Classification Level Classification E-value
Superfamily PA domain 0.0000157
Family PA domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386340832|ref|YP_006037198.1|
Sequence length 532
Comment peptidase M28 [Shewanella baltica OS117]
Sequence
MKNIILATSLMATISLPVLAETAFVQSLDLAQYRTDVKTLASDAFGGRAPLSEGETLTLD
YLVKAFKDMGLKPGFGDSYLQAVPLAQISADQNMQLDIGGLKFANGSEFTARTQRIAETV
SLNKSDVVFVGYGINAPEYGWNDYQGLDVKGKTVIVLVNDPGFATQDPAVFKGNAMTYYG
RWTYKYEEAARQGAEAVFIVHETAPAAYGWGVVQNSNTGTKFTLVDANNNQGQVGVMGWV
QHETAQKIFTKAGLDFDTLKQQAAKPNFKAIPLKLSAQLTLNNKIERAESHNVAALLPGK
TRPDEVVMMHAHWDHLGTVIEDGKSEILNGAVDNASGVAGVLALARYFKQQAKTAPLDRS
VLFSAFTAEETGLIGAQHFAQHPSVPTKNIVAFLNIDGMNVNKGVDYILRYGEDVSELEQ
YLDIAAKAQERSVKADPRPQNGLMFRSDHFALAQQGVPGLLFMSLGDTDPDYIAHKYHKP
ADDYDPSWNLGGVSQDLDLIASMITSLANSTDWPHWLESSDFKAKREQDGRK
Download sequence
Identical sequences WP_014620702.1.8014 WP_014620702.1.86146 gi|386340832|ref|YP_006037198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]