SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386339776|ref|YP_006036142.1| from Shewanella baltica OS117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386339776|ref|YP_006036142.1|
Domain Number 1 Region: 165-223,253-396,539-651
Classification Level Classification E-value
Superfamily Subtilisin-like 1.26e-64
Family Subtilases 0.00055
Further Details:      
 
Domain Number 2 Region: 444-495
Classification Level Classification E-value
Superfamily PA domain 0.00000000051
Family PA domain 0.01
Further Details:      
 
Domain Number 3 Region: 1178-1257
Classification Level Classification E-value
Superfamily PKD domain 0.0000000177
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386339776|ref|YP_006036142.1|
Sequence length 1286
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Shewanella baltica OS117]
Sequence
MKTKLSIAISAALLSSAAIANSEFTFKPYSPEITSHDKFSKPKVATTNLGAPQRFIVEME
SPALAKYQGGIGSFAATASAKEGQKINVQSAEVKNYANHLTKEQNNFSSALAKTVPNAKV
ERHFQTLFNGVTVVGQGLTAEKLAQMPGVKSVYPETMYEISMDASHQIINTQAMWDAVSG
MENAGKGVKVAVIDGGIRPENPMFADAGFTAPSGNLPSDDYCSTVDASFCNNKLIVARWS
QPTFPVCADEYMSPLGFGGHGTHVAGTAVGNKVSTTFKEIPVELSGVAPAAYLMVYKALY
SKADCTGGSGSNIMLMEALEHAVNDGADVINNSWGGGAGGDPASSPYKTMFEAAEAAGVV
VVTAAGNDGNGPQTIGCPACIESGITVANTTTGRFFANSFNAGGDDLLAIPSSDAVLSED
ITAPVIAAVNLDAENANGCDAFAADSFKDGIALISRGTCNFSLKATNAKAAGAKALVVYN
NAAGAPTTMSMPGEPFPAVMITKDAGLAVIEAMGDTVTTGTIVAKTKRIMVSELADNLNS
TSSRGPDGNQNILKPDIAAPGTNILSAFSPDDGGEDFNMISGTSMASPHVAGAAALMSQL
HPEWSANDIKTALTSTAKFEGILDDDAVTPATPFDMGAGRMDLDAAAKAVLTFDKPSIAS
DSCVGPCTFTRTVYNKSDATTSWSLSTSSDSTGITVSPSTLELAAGASATFTVTVDSTFA
TYGEWIFGNVLINSTEGLQNAHLPLAILAKESSNASLISTLTTKTDITASDVIPLVATVN
NNVFANTVTVTAQAPKGTKLTSKDDVKVTLAGATQNGLQVNEDLGAVTWVGQLDLPKMAT
TKGAQRFPSIVDLGVVPVTCLEGCDEQAFTFTVPSFKYNGVSYGNITISDNGLAIVGGGS
ASGTYTNKQLPDGSNPNNILAPFWSDFDLSDKSVGDTGGGDLAVGVFTDGAGVKWLALEW
NKGQLYGDTSGTSYTFSIWIRTGDTEEVVFNYIDIPNMPANVTIGAENVGGTIGTTYNFN
GTGGSIATGDALTLKNTTAGNVTINYDVKATTLNVGQADVIETNEEALVSINVLENDTKP
DMKVARVSITGDGITANAQRIIDIMPKGALGNLAIVQAPSHGTAVINSTGGIDYTPSKDY
FGSDMLSYTSADEDGNTGGAATVTIDVKNVNDAPVVAPQPQSGVAGNAITLKPNPLDVDG
DVLSYVWAQTGGETLEFTPTNENITVTPSSAGTYTFTVIANDGKLQSNTGELVLTVKSKP
DTSSGGALGWLTALLLPLAAMRRRMK
Download sequence
Identical sequences WP_014620601.1.8014 gi|386339776|ref|YP_006036142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]