SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386339899|ref|YP_006036265.1| from Shewanella baltica OS117

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386339899|ref|YP_006036265.1|
Domain Number 1 Region: 34-202
Classification Level Classification E-value
Superfamily E set domains 5.46e-64
Family E-set domains of sugar-utilizing enzymes 0.00000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386339899|ref|YP_006036265.1|
Sequence length 481
Comment GlcNAc-binding protein A [Shewanella baltica OS117]
Sequence
MANPTVFSPVSKLSLLAAAVMAANTFVSISAQAHGYVVVPESRSYACKTGNNANCGAVQW
EPQSVEGPSGFPESGPVDGKLASAGNGAFSPLDEQSPSRWSKTDIKAGWNKFSWQFTANH
VTRNWRYYLTRQDWNQNQALSRASFDLAPFCVVDGGMVQPPKLVTHDCYVPEGRSGYQVI
LAVWEVGDTTNSFYNAIDVNLDSGPVVPGEWLDVGDINPSLDLKAGDKVMTRVFDANGEQ
PAKQTVITISDATQGDKQNWPFLLASAINAQQFQLKAGQKNASGVIEPVYGKNDIFTATT
SGIERVEVGFDLAPAPGNSLEVTSLADDYQIIDGAAQVRFDVTSNAEMLVSAYLFSHDGT
AAGFVSQTVNNTSASLVLDVVAPKAGHYHLQVKAEPKQGDVIQQNFDLFLKDQAPTPEAD
FVFPEGVKGYVAGTTVLQPKNGKVYQCKPFPYSGYCMQWSASATGFEPGVGASWAMAWTE
L
Download sequence
Identical sequences A3D108
gi|126173141|ref|YP_001049290.1| 325240.Sbal_0896 gi|386339899|ref|YP_006036265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]