SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386598212|ref|YP_006099718.1| from Escherichia coli IHE3034

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386598212|ref|YP_006099718.1|
Domain Number 1 Region: 95-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000732
Family NfeD domain-like 0.0089
Further Details:      
 
Weak hits

Sequence:  gi|386598212|ref|YP_006099718.1|
Domain Number - Region: 33-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000589
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386598212|ref|YP_006099718.1|
Sequence length 152
Comment nodulation efficiency family protein [Escherichia coli IHE3034]
Sequence
MMELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLLPLGWEWQGVMF
AVLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS
WPVSASEDLGAGTHVEVIAIEGITLIIRAVIA
Download sequence
Identical sequences A0A061YMN3 A0A0E2LNW8 A0A0H2YWL0 A0A192CJG5 A0A1X3K832 E9XPE8 F4SUW0 L2XVU8 Q1RF40 S0VZ42 S1PK68 T5V8R7 U9XID6 W1WLS2 W8ZNA3
gi|117622751|ref|YP_851664.1| WP_000970318.1.100014 WP_000970318.1.100052 WP_000970318.1.100227 WP_000970318.1.100281 WP_000970318.1.100304 WP_000970318.1.100531 WP_000970318.1.100685 WP_000970318.1.100688 WP_000970318.1.100735 WP_000970318.1.100738 WP_000970318.1.100898 WP_000970318.1.101087 WP_000970318.1.101148 WP_000970318.1.101399 WP_000970318.1.101769 WP_000970318.1.10181 WP_000970318.1.101855 WP_000970318.1.101926 WP_000970318.1.102104 WP_000970318.1.102144 WP_000970318.1.10326 WP_000970318.1.10381 WP_000970318.1.10492 WP_000970318.1.10573 WP_000970318.1.10697 WP_000970318.1.10744 WP_000970318.1.10814 WP_000970318.1.10842 WP_000970318.1.10849 WP_000970318.1.11057 WP_000970318.1.11217 WP_000970318.1.11250 WP_000970318.1.11315 WP_000970318.1.11531 WP_000970318.1.11607 WP_000970318.1.11612 WP_000970318.1.11956 WP_000970318.1.12009 WP_000970318.1.12010 WP_000970318.1.12050 WP_000970318.1.12076 WP_000970318.1.12088 WP_000970318.1.12151 WP_000970318.1.12174 WP_000970318.1.12761 WP_000970318.1.12830 WP_000970318.1.12917 WP_000970318.1.12956 WP_000970318.1.12976 WP_000970318.1.12991 WP_000970318.1.1314 WP_000970318.1.13205 WP_000970318.1.1323 WP_000970318.1.13271 WP_000970318.1.13393 WP_000970318.1.13469 WP_000970318.1.13473 WP_000970318.1.13662 WP_000970318.1.13934 WP_000970318.1.14023 WP_000970318.1.14331 WP_000970318.1.14509 WP_000970318.1.14581 WP_000970318.1.14607 WP_000970318.1.14616 WP_000970318.1.14807 WP_000970318.1.14934 WP_000970318.1.14935 WP_000970318.1.15624 WP_000970318.1.15654 WP_000970318.1.15857 WP_000970318.1.15863 WP_000970318.1.15949 WP_000970318.1.15984 WP_000970318.1.1604 WP_000970318.1.16067 WP_000970318.1.16117 WP_000970318.1.16131 WP_000970318.1.16396 WP_000970318.1.16667 WP_000970318.1.16780 WP_000970318.1.16798 WP_000970318.1.16807 WP_000970318.1.17014 WP_000970318.1.17028 WP_000970318.1.17206 WP_000970318.1.17387 WP_000970318.1.17584 WP_000970318.1.17925 WP_000970318.1.1802 WP_000970318.1.18024 WP_000970318.1.18337 WP_000970318.1.18348 WP_000970318.1.18394 WP_000970318.1.18461 WP_000970318.1.18472 WP_000970318.1.18556 WP_000970318.1.18581 WP_000970318.1.1862 WP_000970318.1.18794 WP_000970318.1.1896 WP_000970318.1.19146 WP_000970318.1.19153 WP_000970318.1.19245 WP_000970318.1.19379 WP_000970318.1.19534 WP_000970318.1.19547 WP_000970318.1.19593 WP_000970318.1.19760 WP_000970318.1.19861 WP_000970318.1.1987 WP_000970318.1.20238 WP_000970318.1.2027 WP_000970318.1.20565 WP_000970318.1.20575 WP_000970318.1.20709 WP_000970318.1.20741 WP_000970318.1.20761 WP_000970318.1.2092 WP_000970318.1.21152 WP_000970318.1.21236 WP_000970318.1.21266 WP_000970318.1.21378 WP_000970318.1.21455 WP_000970318.1.21537 WP_000970318.1.21634 WP_000970318.1.21714 WP_000970318.1.21899 WP_000970318.1.22161 WP_000970318.1.22189 WP_000970318.1.22203 WP_000970318.1.22272 WP_000970318.1.2242 WP_000970318.1.2245 WP_000970318.1.22464 WP_000970318.1.22549 WP_000970318.1.22576 WP_000970318.1.22602 WP_000970318.1.22824 WP_000970318.1.22917 WP_000970318.1.22993 WP_000970318.1.23109 WP_000970318.1.2322 WP_000970318.1.23230 WP_000970318.1.23522 WP_000970318.1.23625 WP_000970318.1.23711 WP_000970318.1.23840 WP_000970318.1.23890 WP_000970318.1.23960 WP_000970318.1.23962 WP_000970318.1.24004 WP_000970318.1.24127 WP_000970318.1.24169 WP_000970318.1.24458 WP_000970318.1.2449 WP_000970318.1.2469 WP_000970318.1.24752 WP_000970318.1.24758 WP_000970318.1.24773 WP_000970318.1.24906 WP_000970318.1.24979 WP_000970318.1.25021 WP_000970318.1.25079 WP_000970318.1.25174 WP_000970318.1.25193 WP_000970318.1.25270 WP_000970318.1.25380 WP_000970318.1.2540 WP_000970318.1.25420 WP_000970318.1.25446 WP_000970318.1.25480 WP_000970318.1.2567 WP_000970318.1.25701 WP_000970318.1.25712 WP_000970318.1.25750 WP_000970318.1.25869 WP_000970318.1.25873 WP_000970318.1.25895 WP_000970318.1.2606 WP_000970318.1.26076 WP_000970318.1.26092 WP_000970318.1.26189 WP_000970318.1.26259 WP_000970318.1.26304 WP_000970318.1.26574 WP_000970318.1.26627 WP_000970318.1.2665 WP_000970318.1.26659 WP_000970318.1.26782 WP_000970318.1.26950 WP_000970318.1.26987 WP_000970318.1.26995 WP_000970318.1.27043 WP_000970318.1.27091 WP_000970318.1.27401 WP_000970318.1.27585 WP_000970318.1.27618 WP_000970318.1.2779 WP_000970318.1.2782 WP_000970318.1.27846 WP_000970318.1.27913 WP_000970318.1.27932 WP_000970318.1.2794 WP_000970318.1.27998 WP_000970318.1.28026 WP_000970318.1.28051 WP_000970318.1.28156 WP_000970318.1.28167 WP_000970318.1.28199 WP_000970318.1.28349 WP_000970318.1.28461 WP_000970318.1.28476 WP_000970318.1.285 WP_000970318.1.28568 WP_000970318.1.28742 WP_000970318.1.28829 WP_000970318.1.28842 WP_000970318.1.29513 WP_000970318.1.29815 WP_000970318.1.29820 WP_000970318.1.29821 WP_000970318.1.29884 WP_000970318.1.29988 WP_000970318.1.30063 WP_000970318.1.3018 WP_000970318.1.30232 WP_000970318.1.30239 WP_000970318.1.30269 WP_000970318.1.3055 WP_000970318.1.30570 WP_000970318.1.30665 WP_000970318.1.30762 WP_000970318.1.30867 WP_000970318.1.30879 WP_000970318.1.30896 WP_000970318.1.30905 WP_000970318.1.30987 WP_000970318.1.31017 WP_000970318.1.31083 WP_000970318.1.31422 WP_000970318.1.3147 WP_000970318.1.31511 WP_000970318.1.31557 WP_000970318.1.31559 WP_000970318.1.31596 WP_000970318.1.31675 WP_000970318.1.31823 WP_000970318.1.31863 WP_000970318.1.32021 WP_000970318.1.32225 WP_000970318.1.32432 WP_000970318.1.3259 WP_000970318.1.32676 WP_000970318.1.3269 WP_000970318.1.32718 WP_000970318.1.33217 WP_000970318.1.33303 WP_000970318.1.33410 WP_000970318.1.33428 WP_000970318.1.3344 WP_000970318.1.33563 WP_000970318.1.34117 WP_000970318.1.34121 WP_000970318.1.34303 WP_000970318.1.3432 WP_000970318.1.34422 WP_000970318.1.34528 WP_000970318.1.3460 WP_000970318.1.34617 WP_000970318.1.3469 WP_000970318.1.3472 WP_000970318.1.34835 WP_000970318.1.34875 WP_000970318.1.34887 WP_000970318.1.34913 WP_000970318.1.34931 WP_000970318.1.35007 WP_000970318.1.35012 WP_000970318.1.35198 WP_000970318.1.35208 WP_000970318.1.35258 WP_000970318.1.35627 WP_000970318.1.35632 WP_000970318.1.35744 WP_000970318.1.35963 WP_000970318.1.35987 WP_000970318.1.36132 WP_000970318.1.36158 WP_000970318.1.3624 WP_000970318.1.36414 WP_000970318.1.3643 WP_000970318.1.365 WP_000970318.1.36545 WP_000970318.1.36667 WP_000970318.1.36761 WP_000970318.1.36799 WP_000970318.1.3697 WP_000970318.1.37306 WP_000970318.1.37313 WP_000970318.1.37342 WP_000970318.1.37360 WP_000970318.1.37423 WP_000970318.1.37544 WP_000970318.1.37550 WP_000970318.1.37736 WP_000970318.1.37853 WP_000970318.1.37984 WP_000970318.1.37998 WP_000970318.1.38000 WP_000970318.1.38194 WP_000970318.1.38234 WP_000970318.1.38293 WP_000970318.1.38300 WP_000970318.1.38561 WP_000970318.1.38937 WP_000970318.1.3912 WP_000970318.1.39196 WP_000970318.1.39232 WP_000970318.1.39254 WP_000970318.1.39289 WP_000970318.1.39325 WP_000970318.1.39327 WP_000970318.1.39335 WP_000970318.1.39401 WP_000970318.1.39708 WP_000970318.1.39709 WP_000970318.1.39713 WP_000970318.1.39796 WP_000970318.1.39809 WP_000970318.1.39867 WP_000970318.1.39892 WP_000970318.1.40107 WP_000970318.1.40140 WP_000970318.1.40211 WP_000970318.1.40300 WP_000970318.1.40345 WP_000970318.1.40360 WP_000970318.1.40539 WP_000970318.1.40560 WP_000970318.1.40607 WP_000970318.1.40636 WP_000970318.1.40657 WP_000970318.1.40660 WP_000970318.1.40715 WP_000970318.1.41453 WP_000970318.1.41482 WP_000970318.1.41847 WP_000970318.1.4189 WP_000970318.1.41923 WP_000970318.1.41990 WP_000970318.1.42044 WP_000970318.1.42228 WP_000970318.1.42350 WP_000970318.1.42413 WP_000970318.1.42597 WP_000970318.1.42601 WP_000970318.1.42638 WP_000970318.1.42670 WP_000970318.1.42709 WP_000970318.1.42804 WP_000970318.1.42808 WP_000970318.1.43170 WP_000970318.1.43278 WP_000970318.1.4334 WP_000970318.1.43422 WP_000970318.1.4343 WP_000970318.1.43733 WP_000970318.1.43803 WP_000970318.1.43918 WP_000970318.1.440 WP_000970318.1.44051 WP_000970318.1.44251 WP_000970318.1.44263 WP_000970318.1.44394 WP_000970318.1.44460 WP_000970318.1.4463 WP_000970318.1.44642 WP_000970318.1.44800 WP_000970318.1.44855 WP_000970318.1.44977 WP_000970318.1.45405 WP_000970318.1.4541 WP_000970318.1.45627 WP_000970318.1.45676 WP_000970318.1.45793 WP_000970318.1.4583 WP_000970318.1.45990 WP_000970318.1.46122 WP_000970318.1.46164 WP_000970318.1.46217 WP_000970318.1.46263 WP_000970318.1.46291 WP_000970318.1.46487 WP_000970318.1.46798 WP_000970318.1.46806 WP_000970318.1.46833 WP_000970318.1.47039 WP_000970318.1.47247 WP_000970318.1.4725 WP_000970318.1.47488 WP_000970318.1.47599 WP_000970318.1.47722 WP_000970318.1.4783 WP_000970318.1.47935 WP_000970318.1.48051 WP_000970318.1.4811 WP_000970318.1.48121 WP_000970318.1.4826 WP_000970318.1.48317 WP_000970318.1.48469 WP_000970318.1.48620 WP_000970318.1.48626 WP_000970318.1.48629 WP_000970318.1.48827 WP_000970318.1.48902 WP_000970318.1.4892 WP_000970318.1.49001 WP_000970318.1.49061 WP_000970318.1.49342 WP_000970318.1.49347 WP_000970318.1.49521 WP_000970318.1.49522 WP_000970318.1.49594 WP_000970318.1.49615 WP_000970318.1.49625 WP_000970318.1.49662 WP_000970318.1.49675 WP_000970318.1.49783 WP_000970318.1.49794 WP_000970318.1.4985 WP_000970318.1.49884 WP_000970318.1.49972 WP_000970318.1.50058 WP_000970318.1.50146 WP_000970318.1.50191 WP_000970318.1.50270 WP_000970318.1.50585 WP_000970318.1.50690 WP_000970318.1.50700 WP_000970318.1.50925 WP_000970318.1.50988 WP_000970318.1.50990 WP_000970318.1.51170 WP_000970318.1.51180 WP_000970318.1.51190 WP_000970318.1.51211 WP_000970318.1.5124 WP_000970318.1.51253 WP_000970318.1.51392 WP_000970318.1.5153 WP_000970318.1.51596 WP_000970318.1.518 WP_000970318.1.51896 WP_000970318.1.51944 WP_000970318.1.5199 WP_000970318.1.52048 WP_000970318.1.52098 WP_000970318.1.52258 WP_000970318.1.52271 WP_000970318.1.52363 WP_000970318.1.52568 WP_000970318.1.52631 WP_000970318.1.52771 WP_000970318.1.53162 WP_000970318.1.53410 WP_000970318.1.53415 WP_000970318.1.53587 WP_000970318.1.5391 WP_000970318.1.54095 WP_000970318.1.54102 WP_000970318.1.54388 WP_000970318.1.54394 WP_000970318.1.54417 WP_000970318.1.54418 WP_000970318.1.54439 WP_000970318.1.54875 WP_000970318.1.55149 WP_000970318.1.55179 WP_000970318.1.55273 WP_000970318.1.5546 WP_000970318.1.55550 WP_000970318.1.55936 WP_000970318.1.55981 WP_000970318.1.56033 WP_000970318.1.56040 WP_000970318.1.56047 WP_000970318.1.56139 WP_000970318.1.56142 WP_000970318.1.56169 WP_000970318.1.56278 WP_000970318.1.5632 WP_000970318.1.56338 WP_000970318.1.56402 WP_000970318.1.56457 WP_000970318.1.56650 WP_000970318.1.56821 WP_000970318.1.56933 WP_000970318.1.56936 WP_000970318.1.57011 WP_000970318.1.57159 WP_000970318.1.57202 WP_000970318.1.57278 WP_000970318.1.5742 WP_000970318.1.57451 WP_000970318.1.57854 WP_000970318.1.58009 WP_000970318.1.58038 WP_000970318.1.58092 WP_000970318.1.58094 WP_000970318.1.58097 WP_000970318.1.58107 WP_000970318.1.58248 WP_000970318.1.58424 WP_000970318.1.58449 WP_000970318.1.58459 WP_000970318.1.58552 WP_000970318.1.58609 WP_000970318.1.58617 WP_000970318.1.58657 WP_000970318.1.59055 WP_000970318.1.59073 WP_000970318.1.5927 WP_000970318.1.59291 WP_000970318.1.5942 WP_000970318.1.59426 WP_000970318.1.59572 WP_000970318.1.59613 WP_000970318.1.59660 WP_000970318.1.59714 WP_000970318.1.59745 WP_000970318.1.59981 WP_000970318.1.60133 WP_000970318.1.60235 WP_000970318.1.60337 WP_000970318.1.60373 WP_000970318.1.60544 WP_000970318.1.60555 WP_000970318.1.60591 WP_000970318.1.60630 WP_000970318.1.61121 WP_000970318.1.61245 WP_000970318.1.613 WP_000970318.1.61442 WP_000970318.1.61445 WP_000970318.1.61480 WP_000970318.1.61789 WP_000970318.1.62038 WP_000970318.1.62102 WP_000970318.1.62236 WP_000970318.1.62784 WP_000970318.1.62788 WP_000970318.1.62819 WP_000970318.1.6282 WP_000970318.1.62866 WP_000970318.1.62951 WP_000970318.1.63285 WP_000970318.1.63330 WP_000970318.1.63487 WP_000970318.1.63814 WP_000970318.1.63944 WP_000970318.1.64053 WP_000970318.1.64312 WP_000970318.1.64330 WP_000970318.1.64417 WP_000970318.1.6446 WP_000970318.1.64520 WP_000970318.1.64670 WP_000970318.1.64840 WP_000970318.1.64875 WP_000970318.1.65114 WP_000970318.1.65116 WP_000970318.1.65122 WP_000970318.1.65286 WP_000970318.1.65355 WP_000970318.1.65405 WP_000970318.1.65456 WP_000970318.1.65606 WP_000970318.1.66017 WP_000970318.1.66044 WP_000970318.1.66071 WP_000970318.1.6618 WP_000970318.1.66255 WP_000970318.1.66290 WP_000970318.1.66295 WP_000970318.1.66376 WP_000970318.1.66511 WP_000970318.1.66668 WP_000970318.1.66751 WP_000970318.1.6698 WP_000970318.1.66984 WP_000970318.1.67029 WP_000970318.1.67055 WP_000970318.1.67153 WP_000970318.1.67174 WP_000970318.1.67258 WP_000970318.1.67284 WP_000970318.1.67373 WP_000970318.1.67427 WP_000970318.1.67456 WP_000970318.1.67464 WP_000970318.1.67495 WP_000970318.1.67590 WP_000970318.1.67606 WP_000970318.1.67690 WP_000970318.1.67737 WP_000970318.1.67894 WP_000970318.1.68058 WP_000970318.1.6810 WP_000970318.1.68157 WP_000970318.1.68177 WP_000970318.1.68231 WP_000970318.1.68362 WP_000970318.1.68524 WP_000970318.1.68572 WP_000970318.1.6859 WP_000970318.1.68632 WP_000970318.1.68735 WP_000970318.1.68795 WP_000970318.1.68847 WP_000970318.1.68877 WP_000970318.1.68911 WP_000970318.1.68952 WP_000970318.1.68995 WP_000970318.1.69327 WP_000970318.1.69502 WP_000970318.1.69506 WP_000970318.1.69643 WP_000970318.1.69716 WP_000970318.1.69831 WP_000970318.1.7001 WP_000970318.1.70300 WP_000970318.1.70337 WP_000970318.1.70386 WP_000970318.1.70408 WP_000970318.1.7050 WP_000970318.1.70655 WP_000970318.1.70686 WP_000970318.1.71139 WP_000970318.1.7121 WP_000970318.1.71294 WP_000970318.1.71311 WP_000970318.1.71405 WP_000970318.1.71562 WP_000970318.1.71563 WP_000970318.1.71607 WP_000970318.1.71732 WP_000970318.1.71855 WP_000970318.1.71972 WP_000970318.1.72028 WP_000970318.1.72048 WP_000970318.1.72066 WP_000970318.1.72212 WP_000970318.1.72290 WP_000970318.1.72352 WP_000970318.1.72359 WP_000970318.1.72388 WP_000970318.1.72469 WP_000970318.1.72588 WP_000970318.1.72619 WP_000970318.1.72700 WP_000970318.1.72706 WP_000970318.1.7281 WP_000970318.1.7309 WP_000970318.1.73215 WP_000970318.1.73291 WP_000970318.1.73344 WP_000970318.1.73486 WP_000970318.1.74046 WP_000970318.1.7407 WP_000970318.1.74267 WP_000970318.1.744 WP_000970318.1.74611 WP_000970318.1.74623 WP_000970318.1.74631 WP_000970318.1.74682 WP_000970318.1.74765 WP_000970318.1.74767 WP_000970318.1.75100 WP_000970318.1.75228 WP_000970318.1.75419 WP_000970318.1.75557 WP_000970318.1.75786 WP_000970318.1.75808 WP_000970318.1.75839 WP_000970318.1.75918 WP_000970318.1.76030 WP_000970318.1.76057 WP_000970318.1.7613 WP_000970318.1.76194 WP_000970318.1.76335 WP_000970318.1.76751 WP_000970318.1.7680 WP_000970318.1.7689 WP_000970318.1.77007 WP_000970318.1.77081 WP_000970318.1.771 WP_000970318.1.77200 WP_000970318.1.77204 WP_000970318.1.77224 WP_000970318.1.77432 WP_000970318.1.77455 WP_000970318.1.7747 WP_000970318.1.77511 WP_000970318.1.7756 WP_000970318.1.7775 WP_000970318.1.7780 WP_000970318.1.78010 WP_000970318.1.78131 WP_000970318.1.78183 WP_000970318.1.78187 WP_000970318.1.78305 WP_000970318.1.78368 WP_000970318.1.78453 WP_000970318.1.78491 WP_000970318.1.78575 WP_000970318.1.78622 WP_000970318.1.78814 WP_000970318.1.78845 WP_000970318.1.78893 WP_000970318.1.78956 WP_000970318.1.79243 WP_000970318.1.79276 WP_000970318.1.79342 WP_000970318.1.79368 WP_000970318.1.79443 WP_000970318.1.79619 WP_000970318.1.79933 WP_000970318.1.79973 WP_000970318.1.80 WP_000970318.1.80016 WP_000970318.1.80026 WP_000970318.1.80096 WP_000970318.1.80392 WP_000970318.1.804 WP_000970318.1.80558 WP_000970318.1.81032 WP_000970318.1.81056 WP_000970318.1.81120 WP_000970318.1.81141 WP_000970318.1.81186 WP_000970318.1.81347 WP_000970318.1.81396 WP_000970318.1.81418 WP_000970318.1.81588 WP_000970318.1.81761 WP_000970318.1.81888 WP_000970318.1.82106 WP_000970318.1.82123 WP_000970318.1.82166 WP_000970318.1.8255 WP_000970318.1.82589 WP_000970318.1.82747 WP_000970318.1.82776 WP_000970318.1.82784 WP_000970318.1.82816 WP_000970318.1.83036 WP_000970318.1.83059 WP_000970318.1.83118 WP_000970318.1.83127 WP_000970318.1.83151 WP_000970318.1.83218 WP_000970318.1.83253 WP_000970318.1.83313 WP_000970318.1.83393 WP_000970318.1.83506 WP_000970318.1.83668 WP_000970318.1.8368 WP_000970318.1.8386 WP_000970318.1.83936 WP_000970318.1.84197 WP_000970318.1.84215 WP_000970318.1.84316 WP_000970318.1.84326 WP_000970318.1.84402 WP_000970318.1.84464 WP_000970318.1.8447 WP_000970318.1.84476 WP_000970318.1.84531 WP_000970318.1.84639 WP_000970318.1.85077 WP_000970318.1.85138 WP_000970318.1.8517 WP_000970318.1.85188 WP_000970318.1.8530 WP_000970318.1.85320 WP_000970318.1.85329 WP_000970318.1.85336 WP_000970318.1.85504 WP_000970318.1.85623 WP_000970318.1.86104 WP_000970318.1.86179 WP_000970318.1.86586 WP_000970318.1.86673 WP_000970318.1.86727 WP_000970318.1.86731 WP_000970318.1.86734 WP_000970318.1.87043 WP_000970318.1.8705 WP_000970318.1.87067 WP_000970318.1.87371 WP_000970318.1.87504 WP_000970318.1.87590 WP_000970318.1.87633 WP_000970318.1.8778 WP_000970318.1.87883 WP_000970318.1.8807 WP_000970318.1.88119 WP_000970318.1.8822 WP_000970318.1.88260 WP_000970318.1.88336 WP_000970318.1.88499 WP_000970318.1.88527 WP_000970318.1.8855 WP_000970318.1.88562 WP_000970318.1.88686 WP_000970318.1.88717 WP_000970318.1.8873 WP_000970318.1.88752 WP_000970318.1.89203 WP_000970318.1.89214 WP_000970318.1.89312 WP_000970318.1.89351 WP_000970318.1.89427 WP_000970318.1.89455 WP_000970318.1.89627 WP_000970318.1.89747 WP_000970318.1.89879 WP_000970318.1.89917 WP_000970318.1.90050 WP_000970318.1.90346 WP_000970318.1.90602 WP_000970318.1.90842 WP_000970318.1.909 WP_000970318.1.90960 WP_000970318.1.90988 WP_000970318.1.91010 WP_000970318.1.91143 WP_000970318.1.91182 WP_000970318.1.9119 WP_000970318.1.91213 WP_000970318.1.91354 WP_000970318.1.91482 WP_000970318.1.91814 WP_000970318.1.91887 WP_000970318.1.91965 WP_000970318.1.92053 WP_000970318.1.92096 WP_000970318.1.92201 WP_000970318.1.92295 WP_000970318.1.92384 WP_000970318.1.92403 WP_000970318.1.92473 WP_000970318.1.92648 WP_000970318.1.93017 WP_000970318.1.93138 WP_000970318.1.93233 WP_000970318.1.93453 WP_000970318.1.93464 WP_000970318.1.93533 WP_000970318.1.93552 WP_000970318.1.93694 WP_000970318.1.93922 WP_000970318.1.94028 WP_000970318.1.9420 WP_000970318.1.94282 WP_000970318.1.94417 WP_000970318.1.94446 WP_000970318.1.94704 WP_000970318.1.94892 WP_000970318.1.94955 WP_000970318.1.94997 WP_000970318.1.95080 WP_000970318.1.95105 WP_000970318.1.95310 WP_000970318.1.95329 WP_000970318.1.95366 WP_000970318.1.95378 WP_000970318.1.95428 WP_000970318.1.9566 WP_000970318.1.95666 WP_000970318.1.95783 WP_000970318.1.95784 WP_000970318.1.95846 WP_000970318.1.95858 WP_000970318.1.95929 WP_000970318.1.96145 WP_000970318.1.96223 WP_000970318.1.96253 WP_000970318.1.96263 WP_000970318.1.9641 WP_000970318.1.96478 WP_000970318.1.96676 WP_000970318.1.9671 WP_000970318.1.96759 WP_000970318.1.96797 WP_000970318.1.96864 WP_000970318.1.97147 WP_000970318.1.97226 WP_000970318.1.97282 WP_000970318.1.97525 WP_000970318.1.97654 WP_000970318.1.97770 WP_000970318.1.97778 WP_000970318.1.98480 WP_000970318.1.98626 WP_000970318.1.98633 WP_000970318.1.98727 WP_000970318.1.98775 WP_000970318.1.99307 WP_000970318.1.99498 WP_000970318.1.9950 WP_000970318.1.99549 WP_000970318.1.99891 gi|91209569|ref|YP_539555.1| gi|544574887|ref|YP_008570411.1| gi|387828505|ref|YP_003348442.1| gi|386598212|ref|YP_006099718.1| gi|386605552|ref|YP_006111852.1| 364106.UTI89_C0523 405955.APECO1_1521 gi|556550641|ref|YP_008720564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]