SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386601121|ref|YP_006102627.1| from Escherichia coli IHE3034

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386601121|ref|YP_006102627.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.69e-109
Family FMN-linked oxidoreductases 0.0000000000112
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.17e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000316
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.72e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386601121|ref|YP_006102627.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Escherichia coli IHE3034]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDANQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVGAVRERVGNDFIIIYRLSMLDLVEGGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLKAFDETILASGIVPRIPPIDGIDHPK
VLSYLDVLRDKAQVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A0E2L2K4 A0A0H2Z3C4 A0A1X3K6B5 A0A2I5STT1 B7MB16 Q1R6P7
gi|117625392|ref|YP_858715.1| gi|386601121|ref|YP_006102627.1| gi|386602821|ref|YP_006109121.1| gi|218560167|ref|YP_002393080.1| gi|91212512|ref|YP_542498.1| WP_000121408.1.100735 WP_000121408.1.100738 WP_000121408.1.100898 WP_000121408.1.101926 WP_000121408.1.102144 WP_000121408.1.10326 WP_000121408.1.10492 WP_000121408.1.10697 WP_000121408.1.11057 WP_000121408.1.11250 WP_000121408.1.11531 WP_000121408.1.12009 WP_000121408.1.12010 WP_000121408.1.12076 WP_000121408.1.12761 WP_000121408.1.14331 WP_000121408.1.14509 WP_000121408.1.15857 WP_000121408.1.15984 WP_000121408.1.17584 WP_000121408.1.1802 WP_000121408.1.19146 WP_000121408.1.19379 WP_000121408.1.1987 WP_000121408.1.2027 WP_000121408.1.20709 WP_000121408.1.21634 WP_000121408.1.21714 WP_000121408.1.22189 WP_000121408.1.2245 WP_000121408.1.22549 WP_000121408.1.23230 WP_000121408.1.23962 WP_000121408.1.24169 WP_000121408.1.24524 WP_000121408.1.25021 WP_000121408.1.25079 WP_000121408.1.25174 WP_000121408.1.25270 WP_000121408.1.25712 WP_000121408.1.2606 WP_000121408.1.26092 WP_000121408.1.26627 WP_000121408.1.26659 WP_000121408.1.26782 WP_000121408.1.27932 WP_000121408.1.28051 WP_000121408.1.285 WP_000121408.1.28842 WP_000121408.1.29513 WP_000121408.1.29820 WP_000121408.1.30269 WP_000121408.1.30570 WP_000121408.1.30896 WP_000121408.1.30905 WP_000121408.1.31559 WP_000121408.1.31823 WP_000121408.1.31863 WP_000121408.1.32718 WP_000121408.1.33217 WP_000121408.1.33563 WP_000121408.1.34303 WP_000121408.1.3432 WP_000121408.1.34835 WP_000121408.1.34913 WP_000121408.1.36132 WP_000121408.1.36158 WP_000121408.1.3624 WP_000121408.1.36414 WP_000121408.1.365 WP_000121408.1.36545 WP_000121408.1.36799 WP_000121408.1.37736 WP_000121408.1.38194 WP_000121408.1.38293 WP_000121408.1.39327 WP_000121408.1.40211 WP_000121408.1.41847 WP_000121408.1.4189 WP_000121408.1.41923 WP_000121408.1.42350 WP_000121408.1.42413 WP_000121408.1.42670 WP_000121408.1.42804 WP_000121408.1.43422 WP_000121408.1.43733 WP_000121408.1.43803 WP_000121408.1.43953 WP_000121408.1.440 WP_000121408.1.44251 WP_000121408.1.44460 WP_000121408.1.4541 WP_000121408.1.45990 WP_000121408.1.46263 WP_000121408.1.46798 WP_000121408.1.46833 WP_000121408.1.47039 WP_000121408.1.48121 WP_000121408.1.48629 WP_000121408.1.49061 WP_000121408.1.49522 WP_000121408.1.49662 WP_000121408.1.49675 WP_000121408.1.49794 WP_000121408.1.50887 WP_000121408.1.518 WP_000121408.1.51896 WP_000121408.1.51944 WP_000121408.1.5199 WP_000121408.1.52363 WP_000121408.1.53410 WP_000121408.1.53587 WP_000121408.1.54102 WP_000121408.1.54388 WP_000121408.1.54394 WP_000121408.1.54875 WP_000121408.1.55179 WP_000121408.1.55273 WP_000121408.1.55550 WP_000121408.1.56650 WP_000121408.1.57854 WP_000121408.1.58009 WP_000121408.1.58107 WP_000121408.1.58459 WP_000121408.1.5927 WP_000121408.1.59613 WP_000121408.1.59714 WP_000121408.1.59894 WP_000121408.1.59981 WP_000121408.1.60591 WP_000121408.1.60630 WP_000121408.1.613 WP_000121408.1.61442 WP_000121408.1.62038 WP_000121408.1.62236 WP_000121408.1.62819 WP_000121408.1.6282 WP_000121408.1.62866 WP_000121408.1.62951 WP_000121408.1.63814 WP_000121408.1.64312 WP_000121408.1.64875 WP_000121408.1.65355 WP_000121408.1.65405 WP_000121408.1.66071 WP_000121408.1.66255 WP_000121408.1.66668 WP_000121408.1.66984 WP_000121408.1.67055 WP_000121408.1.67284 WP_000121408.1.67373 WP_000121408.1.67495 WP_000121408.1.67894 WP_000121408.1.68058 WP_000121408.1.68231 WP_000121408.1.6859 WP_000121408.1.68735 WP_000121408.1.68877 WP_000121408.1.68911 WP_000121408.1.69327 WP_000121408.1.69502 WP_000121408.1.70300 WP_000121408.1.70386 WP_000121408.1.70408 WP_000121408.1.70655 WP_000121408.1.71562 WP_000121408.1.71972 WP_000121408.1.72048 WP_000121408.1.72098 WP_000121408.1.72596 WP_000121408.1.72706 WP_000121408.1.7309 WP_000121408.1.7407 WP_000121408.1.744 WP_000121408.1.74426 WP_000121408.1.74623 WP_000121408.1.74767 WP_000121408.1.76057 WP_000121408.1.76194 WP_000121408.1.76335 WP_000121408.1.77007 WP_000121408.1.77081 WP_000121408.1.7747 WP_000121408.1.77511 WP_000121408.1.78187 WP_000121408.1.804 WP_000121408.1.80558 WP_000121408.1.81186 WP_000121408.1.81347 WP_000121408.1.81396 WP_000121408.1.81418 WP_000121408.1.82166 WP_000121408.1.82589 WP_000121408.1.83218 WP_000121408.1.83313 WP_000121408.1.83393 WP_000121408.1.83506 WP_000121408.1.83668 WP_000121408.1.83936 WP_000121408.1.84197 WP_000121408.1.84326 WP_000121408.1.86586 WP_000121408.1.8705 WP_000121408.1.87504 WP_000121408.1.87590 WP_000121408.1.88260 WP_000121408.1.88562 WP_000121408.1.89351 WP_000121408.1.89427 WP_000121408.1.89747 WP_000121408.1.90171 WP_000121408.1.90602 WP_000121408.1.9119 WP_000121408.1.91482 WP_000121408.1.91887 WP_000121408.1.92053 WP_000121408.1.92201 WP_000121408.1.92403 WP_000121408.1.92648 WP_000121408.1.93533 WP_000121408.1.93694 WP_000121408.1.9420 WP_000121408.1.94282 WP_000121408.1.94446 WP_000121408.1.95310 WP_000121408.1.95858 WP_000121408.1.96478 WP_000121408.1.96633 WP_000121408.1.96676 WP_000121408.1.96797 WP_000121408.1.97282 WP_000121408.1.97525 WP_000121408.1.97654 WP_000121408.1.97778 WP_000121408.1.98727 WP_000121408.1.98775 WP_000121408.1.99401 WP_000121408.1.9950 WP_000121408.1.99549 gi|544577645|ref|YP_008573169.1| 364106.UTI89_C3521 405955.APECO1_3335 585035.ECS88_3478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]