SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386599535|ref|YP_006101041.1| from Escherichia coli IHE3034

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386599535|ref|YP_006101041.1|
Domain Number 1 Region: 14-113
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 5.62e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386599535|ref|YP_006101041.1|
Sequence length 116
Comment PTS system, N,N'-diacetylchitobiose-specific EIIA component [Escherichia coli IHE3034]
Sequence
MMDLDNIPDTQTEAEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKTMMDQSRMA
LNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQDHLMTSMLARELITELIELHEKLKA
Download sequence
Identical sequences A0A029HZR5 A0A029ITY1 A0A0E2L432 A0A0H2YZF7 A0A1X3KBK0 A0A2G8ZXE7 B7MAU7 B7MVL5 Q1RB59
gi|91210950|ref|YP_540936.1| WP_000968925.1.100735 WP_000968925.1.100738 WP_000968925.1.100898 WP_000968925.1.101926 WP_000968925.1.102144 WP_000968925.1.10326 WP_000968925.1.10492 WP_000968925.1.10697 WP_000968925.1.11057 WP_000968925.1.11217 WP_000968925.1.11250 WP_000968925.1.11399 WP_000968925.1.11531 WP_000968925.1.12009 WP_000968925.1.12010 WP_000968925.1.12076 WP_000968925.1.12761 WP_000968925.1.1323 WP_000968925.1.14331 WP_000968925.1.14509 WP_000968925.1.15624 WP_000968925.1.15857 WP_000968925.1.15984 WP_000968925.1.16608 WP_000968925.1.17584 WP_000968925.1.1802 WP_000968925.1.19146 WP_000968925.1.19379 WP_000968925.1.19534 WP_000968925.1.1987 WP_000968925.1.2027 WP_000968925.1.20709 WP_000968925.1.20761 WP_000968925.1.21634 WP_000968925.1.21714 WP_000968925.1.22189 WP_000968925.1.2245 WP_000968925.1.22549 WP_000968925.1.23230 WP_000968925.1.23962 WP_000968925.1.24169 WP_000968925.1.2502 WP_000968925.1.25021 WP_000968925.1.25079 WP_000968925.1.25174 WP_000968925.1.25270 WP_000968925.1.25712 WP_000968925.1.2606 WP_000968925.1.26092 WP_000968925.1.26627 WP_000968925.1.26659 WP_000968925.1.26782 WP_000968925.1.27932 WP_000968925.1.2794 WP_000968925.1.28051 WP_000968925.1.285 WP_000968925.1.28842 WP_000968925.1.29513 WP_000968925.1.29820 WP_000968925.1.30269 WP_000968925.1.30570 WP_000968925.1.30896 WP_000968925.1.30905 WP_000968925.1.31559 WP_000968925.1.31823 WP_000968925.1.31863 WP_000968925.1.32718 WP_000968925.1.33190 WP_000968925.1.33217 WP_000968925.1.33563 WP_000968925.1.34303 WP_000968925.1.3432 WP_000968925.1.34835 WP_000968925.1.34913 WP_000968925.1.35253 WP_000968925.1.36132 WP_000968925.1.36158 WP_000968925.1.3624 WP_000968925.1.36414 WP_000968925.1.365 WP_000968925.1.36545 WP_000968925.1.36799 WP_000968925.1.37313 WP_000968925.1.37736 WP_000968925.1.38194 WP_000968925.1.38293 WP_000968925.1.38567 WP_000968925.1.39327 WP_000968925.1.40211 WP_000968925.1.41847 WP_000968925.1.4189 WP_000968925.1.41923 WP_000968925.1.42350 WP_000968925.1.42413 WP_000968925.1.42670 WP_000968925.1.42804 WP_000968925.1.43422 WP_000968925.1.43733 WP_000968925.1.43803 WP_000968925.1.440 WP_000968925.1.44251 WP_000968925.1.44460 WP_000968925.1.4541 WP_000968925.1.45990 WP_000968925.1.46263 WP_000968925.1.46798 WP_000968925.1.46833 WP_000968925.1.47024 WP_000968925.1.47039 WP_000968925.1.48121 WP_000968925.1.48620 WP_000968925.1.48629 WP_000968925.1.49061 WP_000968925.1.49522 WP_000968925.1.49662 WP_000968925.1.49675 WP_000968925.1.49794 WP_000968925.1.4985 WP_000968925.1.50887 WP_000968925.1.518 WP_000968925.1.51896 WP_000968925.1.51944 WP_000968925.1.5199 WP_000968925.1.52363 WP_000968925.1.53410 WP_000968925.1.53587 WP_000968925.1.54102 WP_000968925.1.54388 WP_000968925.1.54394 WP_000968925.1.54875 WP_000968925.1.55179 WP_000968925.1.55273 WP_000968925.1.55550 WP_000968925.1.56650 WP_000968925.1.57854 WP_000968925.1.58009 WP_000968925.1.58107 WP_000968925.1.58424 WP_000968925.1.58459 WP_000968925.1.58657 WP_000968925.1.5927 WP_000968925.1.59291 WP_000968925.1.59613 WP_000968925.1.59714 WP_000968925.1.59894 WP_000968925.1.59981 WP_000968925.1.60591 WP_000968925.1.60630 WP_000968925.1.613 WP_000968925.1.6138 WP_000968925.1.61442 WP_000968925.1.62038 WP_000968925.1.62043 WP_000968925.1.62236 WP_000968925.1.62819 WP_000968925.1.6282 WP_000968925.1.62866 WP_000968925.1.62951 WP_000968925.1.63814 WP_000968925.1.64312 WP_000968925.1.64875 WP_000968925.1.65355 WP_000968925.1.65405 WP_000968925.1.66071 WP_000968925.1.66255 WP_000968925.1.66668 WP_000968925.1.66984 WP_000968925.1.67055 WP_000968925.1.67284 WP_000968925.1.67373 WP_000968925.1.67495 WP_000968925.1.67894 WP_000968925.1.68058 WP_000968925.1.68231 WP_000968925.1.6859 WP_000968925.1.68735 WP_000968925.1.68877 WP_000968925.1.68911 WP_000968925.1.69327 WP_000968925.1.69438 WP_000968925.1.69502 WP_000968925.1.70300 WP_000968925.1.70386 WP_000968925.1.70408 WP_000968925.1.70655 WP_000968925.1.71562 WP_000968925.1.71607 WP_000968925.1.71972 WP_000968925.1.72048 WP_000968925.1.72551 WP_000968925.1.72588 WP_000968925.1.72596 WP_000968925.1.72706 WP_000968925.1.7309 WP_000968925.1.7407 WP_000968925.1.74267 WP_000968925.1.744 WP_000968925.1.74426 WP_000968925.1.74623 WP_000968925.1.74767 WP_000968925.1.76057 WP_000968925.1.76194 WP_000968925.1.76335 WP_000968925.1.77007 WP_000968925.1.77081 WP_000968925.1.7747 WP_000968925.1.77511 WP_000968925.1.78187 WP_000968925.1.79342 WP_000968925.1.804 WP_000968925.1.80558 WP_000968925.1.81186 WP_000968925.1.81347 WP_000968925.1.81396 WP_000968925.1.81418 WP_000968925.1.81761 WP_000968925.1.82166 WP_000968925.1.82589 WP_000968925.1.83218 WP_000968925.1.83313 WP_000968925.1.83393 WP_000968925.1.83506 WP_000968925.1.83668 WP_000968925.1.83936 WP_000968925.1.84197 WP_000968925.1.84326 WP_000968925.1.85781 WP_000968925.1.86586 WP_000968925.1.8705 WP_000968925.1.87504 WP_000968925.1.87590 WP_000968925.1.88260 WP_000968925.1.88562 WP_000968925.1.88941 WP_000968925.1.89351 WP_000968925.1.89427 WP_000968925.1.89747 WP_000968925.1.90602 WP_000968925.1.9119 WP_000968925.1.91220 WP_000968925.1.91482 WP_000968925.1.91666 WP_000968925.1.91814 WP_000968925.1.91887 WP_000968925.1.92053 WP_000968925.1.92201 WP_000968925.1.92403 WP_000968925.1.92648 WP_000968925.1.93533 WP_000968925.1.93694 WP_000968925.1.9420 WP_000968925.1.94282 WP_000968925.1.94446 WP_000968925.1.94704 WP_000968925.1.95310 WP_000968925.1.95858 WP_000968925.1.96253 WP_000968925.1.96478 WP_000968925.1.96633 WP_000968925.1.96676 WP_000968925.1.96797 WP_000968925.1.97282 WP_000968925.1.97525 WP_000968925.1.97654 WP_000968925.1.97778 WP_000968925.1.98727 WP_000968925.1.98757 WP_000968925.1.98775 WP_000968925.1.99401 WP_000968925.1.9950 WP_000968925.1.99549 gi|544576160|ref|YP_008571684.1| gi|218689677|ref|YP_002397889.1| gi|386604295|ref|YP_006110595.1| 364106.UTI89_C1929 405955.APECO1_805 585035.ECS88_1788 585397.ECED1_1938 gi|117623908|ref|YP_852821.1| gi|386599535|ref|YP_006101041.1| gi|218558604|ref|YP_002391517.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]