SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428308588|ref|YP_007119565.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428308588|ref|YP_007119565.1|
Domain Number - Region: 63-139
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0051
Family Clc chloride channel 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428308588|ref|YP_007119565.1|
Sequence length 150
Comment hypothetical protein Mic7113_0226 [Microcoleus sp. PCC 7113]
Sequence
MTSNPSTSPRLKEIFRAILSVSIIVVGITHFVKPLEYASIVPPQFGDRLAMVYISGFFEI
LGGIGLLIPLVSVAAAWGLIALFIAVFPANIYQAIHSIPIEGIPHHPLFYWFRLPFQAVF
MAWAWWYTRKPEEQPGASSVESLVESSMNR
Download sequence
Identical sequences K9W8T2
WP_015180323.1.75295 gi|428308588|ref|YP_007119565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]