SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428308606|ref|YP_007119583.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308606|ref|YP_007119583.1|
Domain Number 1 Region: 14-423
Classification Level Classification E-value
Superfamily Clc chloride channel 1.05e-71
Family Clc chloride channel 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428308606|ref|YP_007119583.1|
Sequence length 431
Comment chloride channel protein EriC [Microcoleus sp. PCC 7113]
Sequence
MLPQKPPTEPSHRWTFPQLFGLVKRNPIMLSRWVIRWAVVGTACGLFAGLYWYILELITH
ALEQFTGSSLLIVMPLAGLVIGLVIYFLGNPGEIAVIVDNIHFRGGRLDARKNPSMLLAS
LVSISAGGSAGPEAPLVQVTGSFGTWFADRLNLDGEELRSMSLAAMAGGFTALFGAPLGG
AMFALEILHHQHVVEYYEALLPAIVSSCASYLVFAAITKLGIAPTWHFPHYTLDNIDDFA
LAIVFGIVGAIAGWLFMAIFRGCDRLFAKIPGPIYVRTTVAGLGLGGFGAVLPLTRYFGH
QELEAVLDGSFPVFFLLGLAFAKMATISLTVTGGWRGGFIIPIFFTGACLGKAIAALIPG
MNPALAMICTMAALNAAVTRTPISTTLLLSKLTNFAPFTPILFASLVGFFLAPKVPLITS
QLKSHPEAIAE
Download sequence
Identical sequences K9W9L0
WP_015180341.1.75295 gi|428308606|ref|YP_007119583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]