SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428308667|ref|YP_007119644.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308667|ref|YP_007119644.1|
Domain Number 1 Region: 937-1029
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.84e-25
Family Pentapeptide repeats 0.0017
Further Details:      
 
Domain Number 2 Region: 312-503
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000679
Family Extended AAA-ATPase domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428308667|ref|YP_007119644.1|
Sequence length 1144
Comment low-complexity protein [Microcoleus sp. PCC 7113]
Sequence
MSLSIRHWLAERHIERRQLGHDSAQIAGIAFRLAQDMEVKSLNPFAISALTDVLELPLKA
AWEAAPALSQLTVGLLRILSRKKPLKRNEGTWLTFQVAYLNALQGILEQESQLRRPWVNR
ALVPTGQEADQSLGDPQLVALIKTLRPGRLSDSQAEQALSLVSDSFLVQQMNNLAIAWFV
ANGTEDTEAKLLTQRLSNGLPGYLLTVIAENPLPLSQLQKFVRLGNLGPLRDTTIAPVPA
QPSELSTASLPLNLNREYYRAALTCALSEPLLAEPFSLKDLYIPLKGRVLREEEYHTPDY
SASASSSSRAVDLMQWAISQLDNKTSIAVIEAAPGGGKTSFCQIWAARVAQKLYPNWMPV
LIRLRDATLGQTLEQTLESAFPVGRFTDTDGWLSPHSPPCLLILDGVDELPRSTQTERYL
WTFMEQVMRFHNQDTDAIGLPRHKIFLTSRRATLDGLIKKSRQTSTLYLPDQLHRIVVEP
MGQDEFRQWFSAWAKLQSKSIAQAYFSFLKHGGAFRQRSSDNKVASLVTRPLMLYLLGIL
HRDGWVDESIFLMESPQVKFEIYDRMTRWLLGEPATGDGPLPELIREGLAHASRSLEAIA
NLLQGRDPQELRRQMQVAALTIIQTGQYQVSSDAITQGVPAKLNTHQALPETIARRSELN
PIVKHASREPITPASPPVLPALFFRSQPKEKAGAGGQGRGEGFNANPAKYNKLSLPYQGS
SHLLPKTSLTPELPPTALSSPLVQLEFSHPSLGGYLGAEEIAKQLTALTQTVPDHYNEVT
FVIHDAVSVAQHLYALLGYGILSAEIEALVIERLRREQRRNSRVFSFSVLFQRLYRFYRA
YCRGQWLDEGVAHQAHSQLSALHNPLNVLQVDAAVGINVFLLLCSGAQEAQISFWPCGNP
EIPQEFDPDQLLSFIGRTAALSPTAFWQRTRGSLKKMQLAEACLNQAMLAEANLARANLS
AAELIGINLVAANLVHANLSGASLAGANLSNANLSDANLEGADLSGANLKGANLKSVNLT
HACLFQAQLDEPLANVSIHSGAIFSLEEFQSYKQSLTPTKILSRGDDELLGEETPIFIES
AEGELMLPEARYRNQYADDEYEGETAQIENIEQEMSAFANDGYSESEDDYGEQETAIANP
LDYP
Download sequence
Identical sequences K9W7P4
gi|428308667|ref|YP_007119644.1| WP_015180402.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]