SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428308818|ref|YP_007119795.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308818|ref|YP_007119795.1|
Domain Number 1 Region: 278-367
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.00000000000000115
Family Pollen allergen PHL P 1 N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428308818|ref|YP_007119795.1|
Sequence length 379
Comment rare lipoprotein A [Microcoleus sp. PCC 7113]
Sequence
MNQRIWSGLSATLLMTTLGTATAGQAQQTSQLDPASENNSPQTQVRQVTATATPASGQPQ
VQPEEVVQVGERNSPIAAAVEQAEVIAKIQAYESGGRQVAILYVRDIPVLTFWDSQPGTN
QRAQVGATPAAPIKTASRQSGSPNRAIRSGELEGAKQYTASSERFDIENNPVWRATAVAA
KLNQLHRDNVDAKAIAVRWNDSDKAFSIQVNGQEVVQINDSTFLPDTTKNLAQDALQATN
RLRRLMGNAPPLRAIAGMPQKRRAAQVAFAPVRAAMSGIASWYGPGFHGNRSASGEVYNQ
NAMTAAHRTLPFGTKVVVTNLNNGRSVVVRINDRGPFIRGRVIDLSAAAARALGVMQTGI
APVQVQVLGDEKTVASDTY
Download sequence
Identical sequences K9W9E0
gi|428308818|ref|YP_007119795.1| WP_015180553.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]