SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428308944|ref|YP_007119921.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308944|ref|YP_007119921.1|
Domain Number 1 Region: 234-412
Classification Level Classification E-value
Superfamily alpha/beta knot 5.3e-48
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0000318
Further Details:      
 
Domain Number 2 Region: 164-243
Classification Level Classification E-value
Superfamily L30e-like 3.88e-19
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428308944|ref|YP_007119921.1|
Sequence length 428
Comment rRNA methylase [Microcoleus sp. PCC 7113]
Sequence
MPKPDRRPHATGKPKRGKPFRDSRENRKFSSAQDKPSDRQERSYTDKPKPGKPSRPQSSG
PKLRHSQGAPADRIERRHAGKGKPHPQKSGSRPEPRGAKFESPYEARHRDRDTDKDRDRD
RDRGGNTYPTQAKRHIPSKSVHKERQDSPNFEPTHPDATSGTDTSEDTDLIYGRHPVLAA
LENQRQLNRVWILPQLRYDPRFHSLLLQAKANGTIIDEVEPRRLSQITEGANHQGVAAQV
APYPYQDLGDLITKAKLSAEQPVLIVCDGINDPHNLGAIIRTAEALGAQGLIIPQRRAVG
VTSTVVKVAAGALETFPIARVVNLSRALEDLKAAGFWIYGMAAGNGKLLHTVQFTGPIVL
VVGSEGSGLSLLTQRCCDVLVSIPLQGKTPSLNASVATAMTLYETYRQRWSNILYLDTLP
KDTFKKEV
Download sequence
Identical sequences K9W800
WP_015180679.1.75295 gi|428308944|ref|YP_007119921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]