SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428309041|ref|YP_007120018.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309041|ref|YP_007120018.1|
Domain Number 1 Region: 4-227,420-663
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.44e-147
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000000892
Further Details:      
 
Domain Number 2 Region: 227-419
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 6.07e-53
Family ValRS/IleRS/LeuRS editing domain 0.00000229
Further Details:      
 
Domain Number 3 Region: 659-854
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 7.66e-42
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309041|ref|YP_007120018.1|
Sequence length 855
Comment leucyl-tRNA synthetase [Microcoleus sp. PCC 7113]
Sequence
MESRYNPAEIEAHWQKIWSEQGIDQTQTESDKPKFYALSMFPYPSGNLHMGHVRNYTITD
VIARTHRMQGYRVLHPMGWDAFGLPAENAAIQRGVHPAKWTYENIAHMKGQLKPLGFSID
WNHELATCSPDYYKWTQWIFLQFLKAGLAYQKEAAVNWDPIDQTVLANEQVDSEGRSWRS
GAKVERKLLRQWFFKITNYAEELLNDLDKLTGWPERVKLMQANWIGKSVGAYLEFPIVGM
DEKIGVFTTRPDTVYGVTYVVLAPEHPLTPKVTTQDRKVAVDAFIQEVSEESELERTAED
KPKRGIPTGGKAINPFTGEEIPIWIADYVLYEYGTGAVMGVPAHDTRDFQFATEQKLPIQ
VAIVRADAADAKVAPKQAYTEPGIVVNSDLFNGMESPHAKEEIIKYAERQGWGKARIQYR
LRDWLISRQRYWGAPIPVIHCPNCGIVPVPEADLPVQLPEDVEFKGGRVSSLAQLEGWAN
VPCPSCGTAAKRETDTMDTFIDSSWYFLRFTDAKNDNQVFDPNKTNDWMPVDQYVGGIEH
AILHLLYSRFFTKVLRDRGLLNFDEPFQRLLTQGMVQGLTYMNPTTGKWIPSAQVDPNDP
KDPETGEKLEVSYKTMSKSKYNGVAPEAVINKYGADTARMFILFKAPPEKDLEWDEADVE
GQFRFLNRVWRLVTDFVAVKGAKPNTPTEGDLTKAEKDLRRAIHTAIKAVTEDLGDEYQF
NTAVSELMKLSNALTDANCKDSPVYVEGIETLILMLAPFAPHIAEELWRQTGHSESVHTA
PWPQYDPDALVADEITLVIQIMGKTRGTVQVPSQADKQALEQYARESEVAQRYLEGKEIK
KVIVVPGKLVNFVVG
Download sequence
Identical sequences K9WAU6
gi|428309041|ref|YP_007120018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]