SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428309067|ref|YP_007120044.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309067|ref|YP_007120044.1|
Domain Number 1 Region: 161-339
Classification Level Classification E-value
Superfamily E set domains 1.82e-61
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000608
Further Details:      
 
Domain Number 2 Region: 77-188
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-23
Family Voltage-gated potassium channels 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309067|ref|YP_007120044.1|
Sequence length 340
Comment Inward rectifier potassium channel [Microcoleus sp. PCC 7113]
Sequence
MGRWGDGARGSGERGKSLLFLTATGYETKMDKKPRPLRPALSGQSLLPTRRENRKKRFDI
VSNRRFDVKRIGVSHSHWRDPYHLLLTLDWPQFFLLTVVSYLATNTLFALLYLAGGDCIK
NARPGSFLDAFFFSVQTMATIGYGAMYPSTDYANLLVTLEALIGLLGVAMTTGLMFARFS
RPTARVLFSRVAVIAPHNGLPTLMLRVANERRNQILEAQIGLSLLRDEVTTEGIFIRRFY
DLKLLRSQTRTFALSWIVMHVIDENSPLYGMTPELLEEAKTDIIATLTGIDETVSQTVHA
RHYYITDEILWNMHFVDIFSHKPDGRRVLDLTRFHDVTPI
Download sequence
Identical sequences K9W8U5
gi|428309067|ref|YP_007120044.1| WP_015180801.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]