SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428309100|ref|YP_007120077.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309100|ref|YP_007120077.1|
Domain Number 1 Region: 174-436
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 8.11e-84
Family Creatinase/aminopeptidase 0.000000295
Further Details:      
 
Domain Number 2 Region: 1-173
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 4.71e-55
Family Creatinase/prolidase N-terminal domain 0.0000676
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309100|ref|YP_007120077.1|
Sequence length 437
Comment Xaa-Pro aminopeptidase [Microcoleus sp. PCC 7113]
Sequence
MIPQTEYTERREQLMAKIGNGTAIFRSAPVAVMHNDVEYVYRQDSDFFYLTGFNEPEAVA
VLAPHHEEHRYILFVQPKEWDKEVWTGYRTGVDAAKEKYGADEAYPIAELGEKLPKYLEK
ADRIYYHLGRDRQFNDCIITHWQQLMATYPKRGTGPIAIESTHPILHAMRLVKSPTELEM
MRKAVEISVEAHNHARKFTQPGRYEYEVQAELEHIFRLRGALGPAYPSIVASGMNSCILH
YIENNRQMQENDLLLIDAGCSYGYYNADITRTFPVGNHFTPEQKILYELVLKAQLEAIAQ
VQPGNPYSSFHDTAVRVLVEGLMDLGLLAGDIEEIIKEEKYKPLYMHRTGHWLGLDVHDA
GVYKHGENWQTLQPGHVVTVEPGLYIGLDAKPAEGQPEIDQRWRGIGIRIEDDVLVTESG
HEVLTAGVPKAIEDMER
Download sequence
Identical sequences K9WA31
WP_015180834.1.75295 gi|428309100|ref|YP_007120077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]