SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428309140|ref|YP_007120117.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309140|ref|YP_007120117.1|
Domain Number 1 Region: 176-290
Classification Level Classification E-value
Superfamily OmpA-like 2.35e-28
Family OmpA-like 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|428309140|ref|YP_007120117.1|
Domain Number - Region: 104-134
Classification Level Classification E-value
Superfamily Prefoldin 0.0628
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309140|ref|YP_007120117.1|
Sequence length 292
Comment outer membrane protein/peptidoglycan-associated (lipo)protein [Microcoleus sp. PCC 7113]
Sequence
MTQSTSSATKTSPKRSTTRPWWLLVLIFRLLLLGVGGGLALIGGIVLANVYPNPNPEKPL
ILKVLEGLDKKSLVRTSSSSPQTPSTSTTGSLELTPVQRQQAQAKLNQLQAQLNSMNEAV
ETLETQLGTSRANETLETRMQAIALQLEGVSSVNPDVQAMGNSSANQLMPVSDSLLSADK
LKVTLPSDLLFEQSNSNLRPEASLILDKIITDLRGYPSSTIRITAHMDTNSNADADRELS
FRRAKAVQQYLVSALGDQYRWVVVGYGGTRPLIANDTDANRQRNRRVEIAVD
Download sequence
Identical sequences K9WA68
gi|428309140|ref|YP_007120117.1| WP_015180874.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]