SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428309185|ref|YP_007120162.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309185|ref|YP_007120162.1|
Domain Number 1 Region: 66-283
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.75e-21
Family DNA repair protein MutS, domain III 0.011
Further Details:      
 
Domain Number 2 Region: 457-564
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.94e-19
Family ABC transporter ATPase domain-like 0.0043
Further Details:      
 
Domain Number 3 Region: 299-413
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.01e-19
Family ABC transporter ATPase domain-like 0.0019
Further Details:      
 
Domain Number 4 Region: 764-839
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000549
Family Smr domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309185|ref|YP_007120162.1|
Sequence length 839
Comment MutS2 family protein [Microcoleus sp. PCC 7113]
Sequence
MIQSETLQLLEWSRLCQHLATFAATKLGAIAAHHLQPPATLSESLDLLTQTKEVYQLEAR
LTSGLSFEGIQDIGESLERAELQGLLSGEELLAIATTLSGVRRLRRVIDDQEDVPILNEL
VAEVRTYPELEQEIHHSIDERGDVADRASPKLAGIRLKLKSLRDRIYQVLQGILQRQGGA
VQQQVITQRGDRFVIPVKAPQKDAIPGIVHDTSSTGATVYVEPNAIVGLSNQLRIHRRQE
QTEEEAILRALTQQVAAVKPDLEKLLAVATALDLATAKARYSLWLQANPPRFIDRQAGET
ITLRELRHPLLVWQQQHEQGTPVVPINVQIQPSIRVVAITGPNTGGKTVTLKTLGLAALM
AKVGLFVPAREPVELPWFDQVLADIGDEQSIEQSLSTFSGHIRRISRILEAIRGESEALQ
VDTLLAPRQNSDEDAAQVESWEDDAQTSNLLQPSTPAPSPSLVLLDEVGAGTDPAEGSAL
AIALLQHLANTAQLTVATTHYGELKALKYQDERFENASVEFDDSTLQPTYRLLWGIPGRS
NALAVARRLGLNPNVVDQAQSLIGGASEDINQVIAGLEAQRRRQETKAKEATQLLQQAER
LHQEVSDRARLLNERERTLKLSQERAVQEALVQAKEEIAQVIRTLQQGPKSAQNAQKATD
ALQEIAQRRLPAKLPAKQKPSFRPKVGDRIRIPRLNQTAEVLSAPDEDGELTVRFGLMKM
TVLLSDVESLDGQKAEMPVKQKPAPAPTPAVASPPSPVVRTDKNTIDIRGKHVADAEFEL
EQGISEATQLGTLWIIHGKGTGKLRQGVHAFLERHPLVERFELAQQAEGGTGVTLAYLK
Download sequence
Identical sequences K9WAB5
gi|428309185|ref|YP_007120162.1| WP_015180916.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]