SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428309283|ref|YP_007120260.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309283|ref|YP_007120260.1|
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily CheY-like 2.13e-33
Family CheY-related 0.0007
Further Details:      
 
Weak hits

Sequence:  gi|428309283|ref|YP_007120260.1|
Domain Number - Region: 142-204
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 0.0785
Family Protein prenylyltransferase 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309283|ref|YP_007120260.1|
Sequence length 242
Comment response regulator containing a CheY-like receiver domain and an HD-GYP domain [Microcoleus sp. PCC 7113]
Sequence
MSTVLVVEDSRSQRECISNQLSWSGLDVIQACDGVEALEQIQANCPDVVLLDIIMPRMDG
YGVCNLLKANPQTQNIPVIFLTGKGQHFALYWSIKHAEAYVAKPWQPKELLDTIKRVLID
TKNLPKSASAAAWTEYGISILKMIELYECRADAWTKYSTQILRLYDYAITAFNQALDIDC
TYSFADQYQRQVQKRWDSILEKLEQTKPCNVCRYYYGKEGLICAVHPSGSMEKPCQDWDF
RA
Download sequence
Identical sequences K9WAQ5
WP_015181014.1.75295 gi|428309283|ref|YP_007120260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]