SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309589|ref|YP_007120566.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309589|ref|YP_007120566.1|
Domain Number 1 Region: 80-147
Classification Level Classification E-value
Superfamily MOP-like 3.64e-19
Family Molybdate/tungstate binding protein MOP 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309589|ref|YP_007120566.1|
Sequence length 148
Comment molybdenum-pterin binding domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MPRKQQGWITFQSSEEERQILEQYCQQSQRTKTEILRELVRSLTPDSPSLQSPTRKPNGK
QEFVTSEVEQASENSELKAMKVSARNVIRGKIKRLVRGAVNTEVTLEISPNVELISIITS
SSAEQLNLSEGKEAYAVIKSSHIMIAME
Download sequence
Identical sequences K9W9V8
WP_015181320.1.75295 gi|428309589|ref|YP_007120566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]