SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428309619|ref|YP_007120596.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309619|ref|YP_007120596.1|
Domain Number 1 Region: 179-352
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.96e-41
Family Pentapeptide repeats 0.0000575
Further Details:      
 
Domain Number 2 Region: 373-482
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 7.06e-32
Family Pentapeptide repeats 0.00038
Further Details:      
 
Domain Number 3 Region: 491-577
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.12e-23
Family Pentapeptide repeats 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|428309619|ref|YP_007120596.1|
Domain Number - Region: 3-106
Classification Level Classification E-value
Superfamily delta-Endotoxin (insectocide), N-terminal domain 0.0889
Family delta-Endotoxin (insectocide), N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309619|ref|YP_007120596.1|
Sequence length 585
Comment low-complexity protein [Microcoleus sp. PCC 7113]
Sequence
MEIAVVAKTILMNMSVPQVDLVSLVSRISLLEERQNLLAKYTVNVKRQLERLIERFNTRA
ELPMLENLQEAIGQLCEKLTYWQQQQHPDWQQNQHPFVDWNGTFDTLDTYESLNGIEAFE
MPVMDEELANRWVKLEEAECDVDEQTNTWPEASPESEISFNTAERAISPSAVSKAISTGE
FLRQYNEQKRDFTGANLSGINLAGKFLSYDLNLSQANLSQAKLAQANLSGINLSGANLRG
AQLSKANLWQTNLKEANLEQADLSHATLKETSLEKANLSKTNLSEANLSQQVNLNGANLS
QANLSKANLRQSTLTQADLSQADLSQANLIETHLEGANFQGINLEQAIYNRATVFPQGFD
IASTGACLIAPHASLKKANFAGADLNDVDLAKAHLQGANLTSTNLQAADLSEANLSQANL
TQANLGSAILLQANLSEANLEEANLEGANLTGADLNGANLKHANLQNTNLAAANLYQANL
KQAKPKVDDRTNFSGANLAGANLVGLNLEKVNLSRANLVSANLCGILLQAANLSGANLSF
ADLAGADLRDANLEKANLKKANLRGVNLNGARLFDTIMPDGTVHE
Download sequence
Identical sequences K9W9X9
gi|428309619|ref|YP_007120596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]