SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428309700|ref|YP_007120677.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309700|ref|YP_007120677.1|
Domain Number 1 Region: 97-466
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.18e-95
Family Amylase, catalytic domain 0.0000433
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000233
Family AMPK-beta glycogen binding domain-like 0.032
Further Details:      
 
Domain Number 3 Region: 469-549
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000152
Family alpha-Amylases, C-terminal beta-sheet domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309700|ref|YP_007120677.1|
Sequence length 550
Comment 1,4-alpha-glucan-branching protein [Microcoleus sp. PCC 7113]
Sequence
MASSIEFSLFAPYNKGASLVGSFSNWEEIPMKKDKEGYFRIMVDLEDGVYQYKFRVQSKS
WFFEPDQWVDVNDPYATDIDDSTQNANVRIKDGERIVDTYVWKHDDKPLPADHELVIYEL
HVGDFSGGEDDPYARGKYKHVVEKLDYLADLGINAIELMPVKEYPGDHSWGYNPRYFFAT
ESSYGTSNELKNLIDECHARGIRVIMDGIYNHSESESPLTQIDHDYWYHHSPRDPDNNWG
PEFNYEFYDENLETYPARKFMGDQVNFWVKEYHIDGIRFDAARQIANYDFMHWIVQEAKK
AAGMKPFYTVAEHIPETTSITNADGPMDGCWHDSFYHCVLEHICGDTFDLERLKDVIDCK
RQGFMGATNVVNYLTNHDHNHVLAELGDRGILDEEAFKRRRLGAVLTMTAVGVPLLWMGE
EFGEYKYKTQEQAKIDWTLLGHDLNRNLFEFCKGLIHLRKNNHALYTENIEFIHENPEAK
VLAYSRWNDEGSRVVVVANFSDDFLAGYTIPNFPENGTWHEWTADYDVEAGDNQIMVDLG
GYEAKVFVWQ
Download sequence
Identical sequences K9WBT6
WP_015181431.1.75295 gi|428309700|ref|YP_007120677.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]