SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428309846|ref|YP_007120823.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309846|ref|YP_007120823.1|
Domain Number 1 Region: 149-448
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.39e-85
Family NadC C-terminal domain-like 0.0000359
Further Details:      
 
Domain Number 2 Region: 15-148
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 6.04e-41
Family NadC N-terminal domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428309846|ref|YP_007120823.1|
Sequence length 457
Comment nicotinate phosphoribosyltransferase [Microcoleus sp. PCC 7113]
Sequence
MNIEDQELILGAEDYSLLTDLYQLTMAACYTGEGFFARPASFELFVRQLPKGFGYLIAMG
LAQALAYLEKFRFTHSQLEALQATGIFAGVPEQFWSILADGRFTGDIWAVPEGTAIFASE
PLLRVEAPLWQAQIVETYLLNTINYQTLVATRAARIRDVAGPEAQLLEFGTRRAFSPQGS
IWAARAAMAAGLDATSNVLAALKLGRKPSGTMAHALVMAISAIEGSEQDAFSAFYRYFPN
AALLIDTYDTIAAAEKLAQREKAGEIQVAGVRLDSGDLVTLSQKVRSLLPNATIFASGDL
DEYEIARLQQEGACIDGYGLGTRLVTGTPVNGIYKLVEIDGIATMKESNNKATYPGRKQI
YRQIIKGKLIQDRLALFGETPLENEQPLLQLVMKQGERVQPPEPLTEISQRTAASVATLS
TSIRQLDDPTPLAVQISDHLLQLTQATQRRQISQLTS
Download sequence
Identical sequences K9WD02
WP_015181573.1.75295 gi|428309846|ref|YP_007120823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]