SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428310265|ref|YP_007121242.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310265|ref|YP_007121242.1|
Domain Number 1 Region: 158-378
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 7.44e-57
Family ATP-binding domain of peptide synthetases 0.00011
Further Details:      
 
Domain Number 2 Region: 3-157
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.04e-33
Family D-Alanine ligase N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428310265|ref|YP_007121242.1|
Sequence length 381
Comment D-alanine--D-alanine ligase [Microcoleus sp. PCC 7113]
Sequence
MAKIRVGLLFGGCSGEHEVSMSSARAIAKALSSDQNANHYELLPVYIQKDGIWQSGELAQ
HVLESGKALPLTGTNEAYLPTSAADAPSSSASSEILPSAATASKLSRVGENIGWSEVDVW
FPILHGPNGEDGTIQGLLKLMQVPFVGSGVLGSALGMDKIAMKMAFTQAGLPQVKYMAVN
RSQIWSNPCVFPKVCDQIEANLGYPCFVKPANLGSSVGIAKVRSRPELEAALDNAASYDR
RIIVEAGVVAREVECAVLGNDQPKASVVGEITYNSDFYDYETKYTEGQADLLIPASLPDS
VATQIQEMALQAFAAVDAAGLARVDFFYIEETGEVLINEINTMPGFTATSMYPQLWAATG
IPFPQLVNQLIELAMERHQSP
Download sequence
Identical sequences K9WDF4
WP_015181988.1.75295 gi|428310265|ref|YP_007121242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]