SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428310375|ref|YP_007121352.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310375|ref|YP_007121352.1|
Domain Number 1 Region: 378-429
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000288
Family HAMP domain 0.0053
Further Details:      
 
Domain Number 2 Region: 501-707
Classification Level Classification E-value
Superfamily PP2C-like 0.00000759
Family PP2C-like 0.017
Further Details:      
 
Weak hits

Sequence:  gi|428310375|ref|YP_007121352.1|
Domain Number - Region: 413-490
Classification Level Classification E-value
Superfamily NAP-like 0.0523
Family NAP-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310375|ref|YP_007121352.1|
Sequence length 709
Comment serine phosphatase RsbU, regulator of sigma subunit [Microcoleus sp. PCC 7113]
Sequence
MIPTPLQNNDRYTRLLGKRSLRVVLIIPFVLQVVGAVGLVGYLSFKNGQKAVNDLAAQLQ
REVSDRVNQHLDNYLAAAYEVTEQNAFAITHGIIDPNDSERLGRFFWKQMKLFKTIGYII
YATPSGDYIGTGYDLYPDRPQTDEVLPRRYGDRLNRTYNLDEQGNRIGIAEVIKYDYRAE
DGYKAIVRAKRPAWVGPILWVESPDIISIGFGTSIYDKNNRLIALIGVDQRLSQISDFLK
QIQVSPSAKIFILERNGLMIASSSSEPPYRLVKGTAERLKAIDSKDPLIQGTAAFLMEQF
GDFKKITNRQQLDFQLKGQRQFVQATPWRDQYGLDWLVVVVVPESDFMAQINANTRNTIL
LCLVALIVAIALGILTARRITRPIERITQASEEMAGGNLEQAIKPGNIIELAKLTNSFNS
MAGQLEELITGLEDKVKERTAELADANAEISALNEQLQAENLRMAAEIEVARKLQQMILP
KDEELKQIPELDITGFMEPTDEVGGDYYDVLRHNGGIKIGIGDVTGHGLESGLIMLMTQT
TIRALLQHQETDSTKFLSTLNRVIYDNAQRMKSRKTISLAMLDYHAGCISLSGQHEEMIV
VRSNGQIERINTDNLGFPLGLLTNIDEFIGQTQVQLQSGDGVVLYTDGIIEAKNDHRQEY
GLERLCNVLSQHWQQTVDEIRQAVVADVQQHIGESKIRDDITLLILKQK
Download sequence
Identical sequences K9WDR5
gi|428310375|ref|YP_007121352.1| WP_015182098.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]