SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428310554|ref|YP_007121531.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310554|ref|YP_007121531.1|
Domain Number 1 Region: 9-85,181-345
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.66e-46
Family Bacterial dinuclear zinc exopeptidases 0.0028
Further Details:      
 
Domain Number 2 Region: 75-189
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.00000000000000168
Family Aminopeptidase/glucanase lid domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428310554|ref|YP_007121531.1|
Sequence length 349
Comment peptidase family protein [Microcoleus sp. PCC 7113]
Sequence
MSAFDYDQLFQTIEELVLHHSPSGVEGEIDQLLMSRFQALGVQAWQDRAGNAIAKIPGRT
SERSIAITAHKDEIGAIVKTVGDEGRVEVRKLGGAFPWVYGEGVVDLLGDKQTISGILSF
GSRHVSHESPQKAQQEDKPVHWEDVWVETKCTPEELEAAGVRVGTRMVIGKHRKRPIRLK
DYMASYTLDNKASVAILLALAQQLKTPSVDTYLVASAKEEVGAIGALYFTQNQGLDALIA
LEICPLSSEYPIEAGEAPVLLSQDGYGIYDEGLNGELRQTAKACNVPLQLAAISGFGSDA
SIAMKFGHVARAACLSFPTQNTHGYEIAHLGAIANCIHILNAYCQTDFG
Download sequence
Identical sequences K9WCM5
WP_015182275.1.75295 gi|428310554|ref|YP_007121531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]